SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|313913|NCBI_GNO_1000151 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|313913|NCBI_GNO_1000151
Domain Number 1 Region: 39-271
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-28
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 2 Region: 347-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000215
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|313913|NCBI_GNO_1000151
Sequence length 474
Sequence
MTSLNHLFPLTDLIVAVGDQIEILTNGSQSNPLKLENYNASVLVALAYDPSLQKLFFSDK
RNRRGHVFSVTFDGIKAQGSVHDVVERGTNESVEALTYDNLEKTLLWTDGTKQSIRRFVV
DREDLHVYENNTIELVHLLRGDKPRGLISDPCTRMLYWTNWNIDKPTIERSYLNGSHREV
IVQKGLFMPHGLGLDVSQQMIYWANNLRHGTFQIERSKVDGSDRELLYEGKGHEMRGQFI
FGLTVGEHDIYWTDWDQKSLWSLPKEGSIDGPVSLRRFQHKPMAVIILQRQPVNCLIDIQ
HSAATTELIHHSEHRSTPAMDSSSELNNTPQEFHVIPVPETDSGLCIGYCFNEGHCFFVN
NEINCSCAENFSGDRCEITDTVDTSRNSCGRSSFPTASDADNSEIFIALMSTSVMCVILI
IAVIILSFRVWRLSSGRSRFKRRVIKGKNYRPAAERVINIEDCCNMNICETTKA
Download sequence
Identical sequences E9G5N7
jgi|Dappu1|313913|NCBI_GNO_1000151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]