SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|314322|NCBI_GNO_1100029 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|314322|NCBI_GNO_1100029
Domain Number 1 Region: 320-537
Classification Level Classification E-value
Superfamily GFP-like 3.14e-57
Family Domain G2 of nidogen-1 0.0000177
Further Details:      
 
Domain Number 2 Region: 1100-1315
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-42
Family YWTD domain 0.00000259
Further Details:      
 
Domain Number 3 Region: 280-317,544-633
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000204
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 631-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000187
Family Merozoite surface protein 1 (MSP-1) 0.065
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|314322|NCBI_GNO_1100029
Domain Number - Region: 948-1072
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000133
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number - Region: 797-934
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000392
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 682-839
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0188
Family Growth factor receptor domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|314322|NCBI_GNO_1100029
Sequence length 1373
Sequence
MSLRRHCAPFVLLLICIILGPNYLIVSAFSKSELLFPFGETDQRLDNETDDYNSIEVPLT
TPVIFYNQTYNSIYVNENGLVSFLTEIASFFSIPFPLDYPTIAPLYSDVDIRARGAVWYR
ETRESVDIKRASVLIQKHFTSGRGFEAKDLFIVTWDDVGFFDRGNDKGNTFQLVIASDGQ
ESFTLFAYPDKGIQWIQGVGKNPNLPDARAQTGFVSGDGRFYLLEGSGSDQVSNLNKLSN
IGVPGLWMFRVGKLGEVDEVESPDLATGDTTLQQPQVAETCAVGSALCHSKAICVDYNPG
FCCQCSTGFIGNGRNCLTEGIPQRINGKVSGKINCLSFQDEDLHSYVVTSDGRAYTAVSK
MNETIGFDLQPLSMLGGVVGWLFARSTSINAPNGYQLTGGKFNFTTTMDFPQTGHRVVIE
QRFHGVDVFNYLRMSINVYGTVPSVAHGSKIEIADYEEEHHKTGLGEFRSSSRRAFRIEG
SSLDIPFTVDHVIHFEECPFASLDNTTVLKLKVGRNFVTYDARELIVRFAMTTKISPLQE
TEDPCVKGQASCVPNSICIADKDTFRCVCNKGYEYYYQEGKDESACVDINECNIGTDRCD
ENALCFDQPGGYECRCKAGYNGDGFNCQKETPCSRVRCPVHSQCIENNQGHPECRCLAGY
QETESQCQLIRSPTADCRTQDKCDMNAQCVYNSQTDQHQCQCVSGFRGDGLTCTLSSESC
EQAANCSPYATCTYDEVLNTHQCRCLPGFEGDGYDCVRPTCILGVCWCPDGYLYVNEKCE
RSVVSGETPVSCNEVNICHPNARCVQSIGNSTAAGTDEQQQQYICQCNDGYVGDGFQCAS
EIGLPIVSTEPPSGSGCDVGGCRSNAMCVYDDEALQSVCVCNDGYRGDGVFCTPIDGCSA
LSDCDANAQCLFSNREQRFQCECNQGYFGDGKSCFRTEQVAEEEEEPGCNEVNNCHVNAA
CTADESSGRYVCVCRSGFNGNGFHCEPSVIGCNVINNCHRDAQCLYDPESIGYRCKCKEG
YTGSGTTCRPLESCVDNEGICHVNALCAWNTEGYYGCRCRDGFRGDGYQCQVIPKHDGKF
LLISHGMSILRVPIQVSPATPGRPIYVQIFQAAVGIDIDCLEGRVYWSDVNGRIITSAAY
NGSHSKVFLNSEIGSPEGIAIDWASRNMYWTDSMRDTVEVANLDSKVRRVLFDTKLINPR
GIAVHPSRGLLFWSDWDRANPKIERANADGTDRRSDFITTDLQLPNSLTIDFERQDICWA
DAGVRRIECVSLDGGNRRIIRSDVKYPFGLTHYGQRLFWTDWEEKTIKSASKDENDKENI
SLQVPLGGQGKLYGIVAVPETCPRVQSACQVASGGCNAEQICLPSGTNGRTCL
Download sequence
Identical sequences E9G6S4
jgi|Dappu1|314322|NCBI_GNO_1100029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]