SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|315154|NCBI_GNO_1300216 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|315154|NCBI_GNO_1300216
Domain Number 1 Region: 27-91
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000112
Family Tachycitin 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|315154|NCBI_GNO_1300216
Sequence length 92
Sequence
MKSTSLPLVFLVVLLAVSLPGSTADPVGTCPAVDGAIPVYLPDSVSCEVFYECSNGLATG
NICPPNPSGVGNLHWNKSINVCDYPENAKCSL
Download sequence
Identical sequences E9G8X2
jgi|Dappu1|315154|NCBI_GNO_1300216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]