SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|315174|NCBI_GNO_1300236 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|315174|NCBI_GNO_1300236
Domain Number 1 Region: 127-164
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 39-121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000271
Family V set domains (antibody variable domain-like) 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|315174|NCBI_GNO_1300236
Sequence length 505
Sequence
MSSSYVEEEHNVDDHELEPVKHHLEILPEAPLTGFALVKRVDETLNLTCQVVKESGPFVK
FQLEWHLPQHSTNRMHNIFNKPGAINTLHLTITKLQESDSGKYRCVARGEKLTQLQHSVD
ISILPRKGTCGDNMFMCSSKSCIPQRYKCDGTPDCGDGADESREICGESPCDGKLHCDDG
RCISKKVCCDKYYDANCTATYEIPCCGKLLNFLAPDFPLQTHHQFHEIGFLQSTMYTIIG
CAVAFVLIVTFTVITVCRVHMRRSAIPNAYSAYRSDTRVWSDLDSYLATSNNRWTRGLLR
SDLSRSPGLVLNSYGDPGGPGPNTSLLVTYNINNGVQLMGRPVEPPPYEEVAAGGHGGGN
RDEPPPPYVSRENLSTNDWSAARNVTNSSNNNPNSSSSSSSNGPFLSAIFSLLVNNSQPL
PGQQPQLGDRVVPQPPPPLELAAERVEEDNNNGDINGNNTGQIWVRPNSNNRAQPNPDTT
TGTTERTSRMHPDPPGSPPPSSSSS
Download sequence
Identical sequences E9G8Z1
jgi|Dappu1|315174|NCBI_GNO_1300236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]