SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|315175|NCBI_GNO_1300237 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|315175|NCBI_GNO_1300237
Domain Number 1 Region: 49-114
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000876
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 178-250
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000236
Family Complement control module/SCR domain 0.005
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|315175|NCBI_GNO_1300237
Domain Number - Region: 116-170
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000129
Family Complement control module/SCR domain 0.0054
Further Details:      
 
Domain Number - Region: 278-317
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000252
Family Complement control module/SCR domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|315175|NCBI_GNO_1300237
Sequence length 386
Sequence
MHYHLIALVLIASTAVLVEIKCQTTNISTTLLETSSTLGTSDGKLGVLHCSAPGPFPNGW
IDATQNLPLGMSKVGRAIVYRCNRNMKQIGASEAVCEISGRWSQNPPQCLASCIVPLVDH
GVIRDAPNGSIISHGENVILECNQSYQPAHGLSKYICNNGTLNVAPRCDPGESPKGNCNR
PDILDGTFVQIDGKNVTRNQTYDIGTEIIYRCQNPGHQMIDTELENSTRICNATTKNWTG
TPPNCVATCRSLIPQSNHSDNDLHLRFDVAYDETALSGGRYKIGTKAIMRCHFGERVIHP
NNTVVVVCQSNGTWRGSRQARRNRVVENNFNRTDSQRMRAELLRQTRRKTFYALEDRPDG
EREYATIHRVGQSPRPSRLAVEYSKL
Download sequence
Identical sequences E9G8Z2
jgi|Dappu1|315175|NCBI_GNO_1300237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]