SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|315478|NCBI_GNO_1400184 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|315478|NCBI_GNO_1400184
Domain Number 1 Region: 5-240,305-356
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.76e-83
Family Type II chitinase 0.000006
Further Details:      
 
Domain Number 2 Region: 234-307
Classification Level Classification E-value
Superfamily Chitinase insertion domain 2.23e-16
Family Chitinase insertion domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|315478|NCBI_GNO_1400184
Sequence length 370
Sequence
MNNQQPMMIVGYYPNWNYRREDASFDTNNIDPRLYTHLIYAYAALNKKTFCLKSTNEWID
IKYEGYKQFTDLKTRNPQLKLMISLGEWTDSTKNKTTKYFQLVSSPRNIDTFVKSALEFL
EKYNFDGLDLHWKYSNTEEDRTGFTNLIVALHNALKPYGYLLSAAVPPTAFAINAGYDVP
VVNKRLDFINVMAYDFHGPWGSETNSELNVDCAINYWIRQGMSPAKINMGIPLYGRSWIL
SSNVTTPPAPAHGPLPKGEVANEDGTMAYYEICDAIHNKGWTVYKTSQAMGPYAVSPAAN
GRMWVGYDDPAMAIAKTNYVLSKGLGGVMLWDISMDDFQGISGAGPNPVTNAIIQTISQY
NSSATMFPFV
Download sequence
Identical sequences E9G9V7
jgi|Dappu1|315478|NCBI_GNO_1400184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]