SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|315516|NCBI_GNO_1400222 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|315516|NCBI_GNO_1400222
Domain Number 1 Region: 27-262,338-385
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.11e-68
Family Type II chitinase 0.0000132
Further Details:      
 
Domain Number 2 Region: 262-337
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000000183
Family Chitinase insertion domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|315516|NCBI_GNO_1400222
Sequence length 430
Sequence
MGHWPTLLVIAASLVLSNIGSISATPRLVCYFNSGASLRKGDGQFTVENIDPFLCTHLIF
VSGIFNSIVSKGEPGSLDPTVKKFVLLKSKNPKLKLMLSVGSWIDFQSAQYTENVMGSNR
ANFAHSAAQFLARYGFDGLDFSWPWDFASPANDPKQFVRVLTALKDAFKSSGYLLSVAVT
ANQSISELSYDFPKIEALVDFVNLKSYNMTDISKSMADHHAPLYTRKWETSGVGSNNVDS
VVSYWINKGVSISKLNVGIPFFGKSWTLSSDAYNPPAKALGPGPAGPLTNTQGELAFYEI
CRHVRVEKDFKAVRSESRLNGPIAYSLRTPGRIWVGYDDVDMVIHKGKYILSKNLGGAVV
WDISMDDFRNTCGSGINPLLASLSRTLKVIGQNAELYVSASPDVSPHFILANMTITMLLL
IFYSRRMYYL
Download sequence
Identical sequences E9G9Z1
jgi|Dappu1|315516|NCBI_GNO_1400222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]