SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|315529|NCBI_GNO_1400235 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|315529|NCBI_GNO_1400235
Domain Number 1 Region: 445-957
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.19e-114
Family alpha-mannosidase, C-terminal domain 0.0000000838
Further Details:      
 
Domain Number 2 Region: 26-354
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.85e-111
Family alpha-mannosidase 0.0000000183
Further Details:      
 
Domain Number 3 Region: 355-449
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 7.19e-28
Family alpha-mannosidase, domain 2 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|315529|NCBI_GNO_1400235
Sequence length 960
Sequence
MHVVTILCLVCSWIKLGESVCYRSPNACPQTEKDFLNVHIVPHSHDDVGWLKTVEQYYYG
TNNSIQNAAVQYTYDSVLEELWKDSEKKFVSVEMEFFSHWWKEQTSHVKRKVHKVVERGQ
LEFVGGGWCMNDEATASYVDIIDQMTMGLKFLNDTFGECAAPKAVWQIDPFGHSKEQASI
FAQMGFEYLFLGRIDYQDKALRMSNGEMEMMWDASDSLGTEIFTGVLYNTYGPPPGFCFD
VLCGDETIVDDPDSPMFNIDRRSKQLVAYILEQSKHYRTNNIILTMGEDFHYQYAHAWYK
NLDKLIKYINKVYFNSQIRLFYSTPSCYGQAVKNALVEALPRKTDDFFPYASDPHAYWTG
YFTSRPTFKGLVRQTSNLLQACKQIQAVTVRRRSNVLNQFQRSQAIAQHHDAVTGTAKQH
VNNDYIVRLDQGIRGCSGVFSESFNHLLSLNGSTLNQEYCAMLNISQCQTTEQNSPFIVT
LYNPLAFRSSHTVRIPVTDGSYAVTDHEGRLVASQMVPIAEAVLLLPGRNSNATNELIFR
AEDLPPLGLRSYHVKTPEGKPGKRMLRSRPRTIQLPNKEDILVSAYGLSLKFDRQTGHLV
QIGNESVQQQLLFYPAMAGNNSRFEFRASGAYIFRPNGTDALPLEQPATKLTTIFGPVTT
EIRQHINTNTMQIFRLHRDESFIELDWILGPIPIEDGIGKEYISRFTAPEIRNNGTFFTD
SNGREMLQRQLNHRLTYKVNVTEPTAGNFYPVNSFAYVEDKSTRSRMTVLNDRAQGVSSL
LPGSLEFMIHRRLLHDDAFGVGEALNETAYGVGLAARGSHWLGVENSRSVARFLAQRMAR
SPILTFSPTALSAEEFRKSYRMEVALLNRDLPPNVNLLTLEPWDDQGRILVRFEHFFGVG
EDEQFSQPASISLKGLFATLNIWTVEEVNLSSNRPIKILDTDELVLKPMEIRTLILSTYQ
Download sequence
Identical sequences E9GA05
jgi|Dappu1|315529|NCBI_GNO_1400235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]