SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|315891|NCBI_GNO_1500239 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|315891|NCBI_GNO_1500239
Domain Number - Region: 86-127
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00116
Family Pan module (APPLE domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|315891|NCBI_GNO_1500239
Sequence length 140
Sequence
MNYRKEDLVTTAESNGRLPPALDVIINNGGFSQIGGTSYGGGVSNGQGNSNSGGGTVDFG
PETAAYYESTVKVFPNCDFPANDISNQTSFEKDCSSICFANFQCNAFSWRDGNCHLKNIP
SPNLRQPANGGICGFLPWKF
Download sequence
Identical sequences E9GB64
jgi|Dappu1|315891|NCBI_GNO_1500239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]