SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|316109|NCBI_GNO_1600184 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|316109|NCBI_GNO_1600184
Domain Number 1 Region: 219-319
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000002
Family C-type lectin domain 0.006
Further Details:      
 
Domain Number 2 Region: 39-197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000174
Family MAM domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|316109|NCBI_GNO_1600184
Sequence length 321
Sequence
MQFLLVLVTVAVSLSKQDEQEKVFILSLEIDPQSARILLNNDFESGSADPWYDSSPSTVH
WDVEDFTMPSEVNYPPAIPLSGTKYLRATRDAQLSPGFVILRTVEFMALPGDRITFKFWI
RSKYTFGNTLELILAIGDTETTLLTLSSYSTSVNVEWRQASTLIPVPEPTVLTLAFYESC
GGNAEDAIAIDDIVLEPSDEITTTGLTTVTSTTTVKPMLKVETEEEEKLIYNHWQVHPEL
KSEKYWTSGKFPQKGYNRTYEWATIEPFQRFTYTNWQSGKPGHSDFGYCVYFFMDFDFES
GYYWVDYLCNSFYLEYICESV
Download sequence
Identical sequences E9GBQ8
jgi|Dappu1|316109|NCBI_GNO_1600184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]