SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|316162|NCBI_GNO_1600237 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|316162|NCBI_GNO_1600237
Domain Number 1 Region: 36-173
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-17
Family C-type lectin domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|316162|NCBI_GNO_1600237
Sequence length 174
Sequence
MPNLKTPSRLILRNYEGSSESDTAEEDRIKMLCWTLNKNCYCFPTPTNKSYSWYEANQFC
KEGNMALLSLENENEDRLVYKHIKSILALNGELYWTSGQHSLRWEWADGESINYTNWKTG
KSEPNEEIKNEAYLYLDTSYDFESGFWFASNNSRLLQSSDNSSFSRPMSYICES
Download sequence
Identical sequences E9GBX3
jgi|Dappu1|316162|NCBI_GNO_1600237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]