SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|316225|NCBI_GNO_1700019 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|316225|NCBI_GNO_1700019
Domain Number 1 Region: 1209-1459
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.79e-79
Family Eukaryotic proteases 0.0000922
Further Details:      
 
Domain Number 2 Region: 1060-1165
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 912-1014
Classification Level Classification E-value
Superfamily SRCR-like 6.54e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00023
Further Details:      
 
Domain Number 4 Region: 648-744
Classification Level Classification E-value
Superfamily Kringle-like 1.88e-21
Family Kringle modules 0.00085
Further Details:      
 
Domain Number 5 Region: 383-491
Classification Level Classification E-value
Superfamily SRCR-like 9.55e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 6 Region: 259-320
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 4.71e-16
Family Tachycitin 0.017
Further Details:      
 
Domain Number 7 Region: 496-643
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000105
Family C-type lectin domain 0.0072
Further Details:      
 
Domain Number 8 Region: 175-236
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000126
Family Tachycitin 0.015
Further Details:      
 
Domain Number 9 Region: 788-869
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000000000228
Family Hairpin loop containing domain 0.032
Further Details:      
 
Domain Number 10 Region: 751-787
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 870-906
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 12 Region: 1019-1058
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|316225|NCBI_GNO_1700019
Sequence length 1464
Sequence
MVAPRVTFQLFILCVSVSLHLCIIDWTQLDQKRSVVTFSSGNVLPGDVTSENENARESPA
GSGPRNTLIVHPGKAKPGETNPIQPETTRSPRVLTPPPLTTPAPTLGNIFDSDGCIFAVE
TPTVTSGPNNAASSMSSSTTPTPAILIDQRAPLRPTTTTTTTTTTVKPTITTRKSASSNM
VCPKPNGLFPYDGDCSKFINCWKGRPHLQSCAGGTLFSPATNECDHAYKVVCQVARSASV
TFPPTTTRPPTPPPTVSTTTTPTPLSCPHPKGFFPHPADCKKFVNCWGGRPAVQVCAEGT
LFNAATRECDHASKVVCLTRIIHLIATSRAIQVQPRGNNAGGSFFSDNVPRSSGSLPPAG
NALPQSPKVDLGPPLSPDSGQLMRLRGGAGPWEGYVEVRGGKDRPWGHVCDAPDSWTIQE
ASVICRHLGFLRGAQKSVQGLEFGPLTRDKILIEKVECTGSEANITGCKIATGSNCPFIH
EQVVGVRCHRDTQALCAKDEHAHGNFCYKLISDEMSTRERARSLCEKSGGNLLYIHSQVE
NDFVSELLNSVAPSITKVHTDGMAIRALRKDLLVWEQMETTMNFTKWWPEWDRSKPGNPA
AKATPQCLILVKRFQYRNRCATLPYFFWTLGECDVAAAAICKKSSRDIGCVVGNGADYQG
TANISKTGMPCLGWNDPRIRHVLAKPARAAVAVLDSAAAKSSRTVSSGLQHNFCRNPHGE
SNPWCFISPVEMEYCDIPRCHIQERGAVLDNKCKANQYKCNTGECIPNTWVCDGATDCEG
GSDEDLCAQYMNDFYKRQNETIQLHDVEKWMNTNLDTCARRCAEAKSFTCLSFNHNEGQS
ECVLSDSNRGLSGQMIHSPGWTYYERKVYSVNCSSNFECPSGKCINQTSVCDGRDDCGDR
SDEIVCQSQLDFQIRLAGSNKTNEGRVEVKVFGQWGAICDDHFSANDANVICRQLGFPLG
ASQALSHSTFGPGSPILMDDVMCRGNETSLADCPFAGWGVHNCAPEETAGVRCILAETTC
TENQFKCETTDACIAIDFLCDTVDDCGDHSDENRTRCASELLVRLADGPDSLSGRVELRQ
NGIWGTVCDDDFGPEEATVICRMLNLNGPAQPAKSGSFGPGKGPIWLDELGCSGTENTLM
ECARLPWAKHNCRHTEDAGVRCSHPTNERKLPEEKTETDPVTTLTDLVQLGSLPVKCGIR
MVEDNPSDPLLIQPKVVKGEPTKPGAYPWQVGVRVRNSGKSDNHWCGATIISEHFILTAA
HCMEDFPKGLYVLRVGDYNTEDSDVEEEQFTVERMHFHEEFGQGGHLNNDIALIRIKKKS
NQGIRFGSHVQPICLPSPSTEYVAGMNCTIAGWGSPGQPGAAFAIKLQSATVPILSDDTC
KAPYVYGPDRIKVGMFCAGLLEGGVDACQGDSGGGLVCLVDGRPTLMGVISWGFGCGRPN
RPGVYTRVVHYLPWIYSKLAETNA
Download sequence
Identical sequences E9GC79
jgi|Dappu1|316225|NCBI_GNO_1700019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]