SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|316840|NCBI_GNO_1800260 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|316840|NCBI_GNO_1800260
Domain Number 1 Region: 79-137
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000034
Family Tachycitin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|316840|NCBI_GNO_1800260
Sequence length 139
Sequence
MQVKEAIAFLGLFIFAAAENSLLVQHPSFKAVSLELSTADVTSEWTPTSANWETSWASTD
VVTLTTSTDTRPSTVTMGPDICANESSDDYIFPNPEDCTTFYLCSNGTPYLYNCPSGLVY
NDAIIQCDYPYNVSPPCNI
Download sequence
Identical sequences E9GE54
jgi|Dappu1|316840|NCBI_GNO_1800260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]