SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|316954|NCBI_GNO_1800374 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|316954|NCBI_GNO_1800374
Domain Number 1 Region: 52-315
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.71e-62
Family Eukaryotic proteases 0.00093
Further Details:      
 
Domain Number 2 Region: 348-410
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000942
Family Tachycitin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|316954|NCBI_GNO_1800374
Sequence length 413
Sequence
MANDYPAAPPKISWVEAAILSRETQQPCIANGKLKSFALNVDQSNADSIPQANQDFKCGV
ANSAVSRIVGGEMSEPNEYPWTVFLNLYFWSGDRATCTGTLIGSKWILTAAHCTFGVVNI
SVVLGSHDTSAGNEPHRQTVVVPAQNIKTYPGYYYGKTEDDMALLELPQEVNYSKYILPA
CLPYSDDSDQVGDPVTLAGWGNYSSIPDSGLSPELRKVQTSVISSSGDNGQCQQLWGNGP
FSGEKVICGDGSTGNRFCYGDDGGPMNYFNNLTESYTVVGVASLGDATINCQSSRLPNIY
GRVRYYLDWIYNNTDIAPTPKPTTTTTTTTTTTTTTTTTTTTTTTEDPTVFSCRNKPDGI
YANPFDDCSIIFYMCFNSNKYEYTCPDAGTVFNPQICACDFPYNVPACGVSNN
Download sequence
Identical sequences E9GEG8
jgi|Dappu1|316954|NCBI_GNO_1800374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]