SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|317319|NCBI_GNO_2000137 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|317319|NCBI_GNO_2000137
Domain Number 1 Region: 190-257
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000764
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 130-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000987
Family Complement control module/SCR domain 0.0053
Further Details:      
 
Domain Number 3 Region: 60-134
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000347
Family Complement control module/SCR domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|317319|NCBI_GNO_2000137
Sequence length 275
Sequence
MMRLSRIHLFVFFVYLWVYYPVNGISNIFKSFPALFDLSLSNNDTSVNVTVHQDAKEICI
PPLLLHGSVDPVKSQYKSQDVIRIICKDGYELENPQSSLLYCSQKGLWKVFTLGDSIYIP
LPRCIVKERCPPLPPLIQGSMQVQEGGVNAVTSELSSTRAVYQCWYGLELDPPESEIRYC
VRGKWTGENPLCVPASCPRPPSVTGGFFIARGVVNHIYVSGAAVKYYCDEGHHQKGPPLL
TCSGKEWIPKDLPACVPIESSAAAGKSLFTSCRSY
Download sequence
Identical sequences E9GFM2
jgi|Dappu1|317319|NCBI_GNO_2000137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]