SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|317568|NCBI_GNO_2100137 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|317568|NCBI_GNO_2100137
Domain Number 1 Region: 291-839
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.3e-167
Family Myeloperoxidase-like 0.0000000351
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|317568|NCBI_GNO_2100137
Domain Number - Region: 869-906
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000334
Family Pan module (APPLE domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|317568|NCBI_GNO_2100137
Sequence length 924
Sequence
MINRYSIIYHHVPESPPRDVWNSGEGGVKWLLNCDFFGNDIGRIEATGEQCGGLCVANPE
CNHFRHSDGTCYLKKTSLNTPRTPINGGVCGYLAFRDFDSCPAVGGLESKCRPVKDCAVW
YDLVLTTPGAGCALADGGPGACCPDLPANSYGAPPLQENEKKAKQYNLAFNSPKQQQQYN
SINNSMNSAADAGKLQMKVTDTIETQLFVKKIFVLPGSSRATHALLFTSTAESEKMSRDA
MMESYTVTEIVKRFNIKPEDVQRTMKQFNLKDTILSGMCTADPVCDEKTIRSPYRTLDGS
CNNIQRPSWGKSLTQFQRALPSAYADGVRTPRRAKNGGELPSARLVSTTVAVDIDSPSQS
DTTWVMQYGQFIDHDFTRTPEFKMGTTSKFQSEEFGQRCMPLVRSAPIRRSDCTFGASEQ
MNQLTHFLDNSNVYGSDDKTARELRTFKKGGMKVTPRNELDLLPADEESKVSCTLSKTVS
GIDPPTDVKCFKTGDTSRVNEHPNLAVTHTIFLREHNRLAAELARLNPGWDDERLYQEAR
RILAAQMQHITFNEWLPVIIGRVKMQELGLLPLQQGSSQDYDKNLNPSVLNEFAAAAFRF
GHTLIQGKHHLTNQRGTKDREILLRQHFFKMQEIYTPGNLDKFLIGLASQPSQNAENYFT
QEVTNHLFEEQGKGFGLDLVSLNLQRGRDHGIPGYNAYRTQCGLPPAGQFSDLLNLISPA
ILDKFAKLYDTVDDIDLFIGAMSERLAPGALVGPTFQCIIADQFLKLKWGDRFFYDLAGQ
PSSFTKDQLTEIRRASFARLVCDNSNGKSSQPLIFKTPSHVNPILNCDSGSIPRLNLRPF
GVEDRWPEYNTGDGGVKWLQNCDFPGYDLSRKTIPGEQCGRLCINDGKCNAFTYNSVTGI
CFLKDIPASYGRSPWNGAICGFLP
Download sequence
Identical sequences E9GGB7
jgi|Dappu1|317568|NCBI_GNO_2100137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]