SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|318862|NCBI_GNO_2600165 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|318862|NCBI_GNO_2600165
Domain Number 1 Region: 411-542
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000628
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 578-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family EGF-type module 0.006
Further Details:      
 
Domain Number 3 Region: 539-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000438
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 4 Region: 349-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000931
Family EGF-type module 0.0085
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|318862|NCBI_GNO_2600165
Domain Number - Region: 181-217,250-309
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000104
Family Fibronectin type III 0.0075
Further Details:      
 
Domain Number - Region: 312-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00038
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 511-535,1000-1303
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000531
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|318862|NCBI_GNO_2600165
Sequence length 1625
Sequence
MATTGSCQSNCLKFDKSRELEVSAGAPPGTIVGKLRVISRAAGGILTSDNVGVNFSLHNS
SDYADFHVEPKTGLLSVAKGEIEPDSPVGMAIIEAMAFVNGSHNQMPGNVTYFMEPFPDE
KFPFTAIKDWFRMDNRTGVVQLLQSPQPGIKAHNVSFSIGALEHDKSLDARARAVVLFHG
LPRPRNVTVTKLSADAAVICWKFPLAAGAQGYVLRYWRHPASLSPTQPLTPTENEAPDSA
PIPLELKIIDLDGRANQSTTKDEIRTVCSSLKQLESEAAYKLQVLACGGDAECGDSLGPA
SAILHFTTQTNHCSLEGTCVTGECQISFEPPGFECLCHSGNYGPRCELYNPCVLTPCQNG
ATCHNFTNSTYECQCPQGFEGENCVVPVGPPCLHEEPCLNNGTCSKDGCDCLPGYQGAQC
ESFNPCWNDPCPKEANCTVLLDSDEFHCVCPLGYRGRDCEEAINYCVLDPCQNDGHCSSR
NGSYHCECTTGFHGVACEQDVDECLSDPCENNSTCHNLPGSFTCLCPPGFTGTRCEQKVE
ACLSFPCRNKAVCQNDFENLSYNCFCRPGFDGRDCENNIDDCNPDPCLNGGTCRDLTDAF
ECLCKTGFSGLRCDHEDPCPEDVEESVEKGTFHWPVTETGQIATLACPYGTLTTLEGKLK
RPAAEIPTGLVTDTEFRERQERTKFDQTTVLTAVRSCERLPDGTVGWNSSDLSVCREQRL
AIAEERSTILENNSVAAKNLTLIGVEQVADEVVDLVDDALMDLKVAHNFFNTLSNVMEVD
DEVLSASNNSCDRLLDAIERYTSQVALEPDQPVVLATPNIAIETLLHSKPESYSFRPSFE
GDPSGSSLISLTIPKQALEGSRDGVRLQFVSYRSGKLFQSRTNRLPGQPAMVIAATVGHV
SVSGLSEPVTYTMPLVNSSSFYSCVYWDELGLNLLSFGGGGNKLVDVIGFSTEKEWSTNG
VKTTKTESGMIECLSDHLTAFSILLDPTPMDRISGYHEYILRLISYVGSGLSILGLSITV
LLYSLFRNLRRDRGGKILLNLCISLLMLNVIFLVGSILGTAYKNVDLEQRAKTSERIWSA
GTESPVSQAHVDICTALTISVHYLVLSSLSWMLVEAVHMYQLLILVFANSETGFMLKRMV
AAWGVPLIVVVTTAVLCLDYYQDPTGQTCGRMSHAHLTVYYSAFIGPTCLILLINSTVFF
MVLRVILLQGQRGRAVGKVATENGNGAGGGNRLMIMAQLRGAVTVMALLGVTWVAGAVAI
GPVKVVMTYVFCVCNSLQGFVIFIVRVVQYPEARQSFVTLWNTGQTHIPYDATRHSSGPT
INSSGSATGQSSAHAVLRARKTLSINSRSPGSSGKNMLPIARGPDSLTPSQAPTLPLGGP
TDSSSPSLSYQHWFPSATASPASNGSTQSRFRRIFGQLGLEPSSLRMSSKSNGKTSGSHS
LLERHVSGATNPPPSPGDKSHQILGEPSPLPEELIKPNFMIGEEISLLHPGAASSSAEPS
AGNTKRSSVISAGGGSISKEGANTSWTYLRPEDEIGDNDQLPPTTDQLGLKSANGFIARR
RAVSFVVNLPDHGSIENPSSIVDRRAPPVRRTQSLCDDPPELSVIFRNGPAQQSSLPRQD
PLFHS
Download sequence
Identical sequences E9GJV7
jgi|Dappu1|318862|NCBI_GNO_2600165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]