SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|319341|NCBI_GNO_2900040 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|319341|NCBI_GNO_2900040
Domain Number 1 Region: 162-281
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-21
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 2 Region: 50-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000288
Family Spermadhesin, CUB domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|319341|NCBI_GNO_2900040
Sequence length 282
Sequence
MTIFPSICLFVLLFLLFSSSSYGNVLPQDSNLCQESLFVKDVAVIDAAQQANCIWRVQTD
ENYILVFTLQSGDGNSEQAQDFVDIHDGLDEYSPILLLENQKVHKVSGKHFPSQALYSTH
SMAIVRFKKTPTSPLRLKIQKAVDCPLNLDSNSECGRVVDEVSCYCITNTTRDHASQMTY
CNDNQMKLLAVETRSKETAIYAAWGTTTVFWTSGSDSANEGIWVWESTNATLPCPGYANW
ANLQPDNAGNNEDCLALNWRSVEGWNDYPCSNLYQAICEAHP
Download sequence
Identical sequences E9GLF3
jgi|Dappu1|319341|NCBI_GNO_2900040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]