SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|319425|NCBI_GNO_2900124 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|319425|NCBI_GNO_2900124
Domain Number 1 Region: 957-1071
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-20
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0048
Further Details:      
 
Domain Number 2 Region: 113-224
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0019
Further Details:      
 
Domain Number 3 Region: 2453-2560
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000000027
Family C-type lectin domain 0.0094
Further Details:      
 
Domain Number 4 Region: 1790-1897
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000419
Family Scavenger receptor cysteine-rich (SRCR) domain 0.01
Further Details:      
 
Domain Number 5 Region: 452-641
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000968
Family Pectate lyase-like 0.051
Further Details:      
 
Domain Number 6 Region: 658-796
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000131
Family Galacturonase 0.066
Further Details:      
 
Domain Number 7 Region: 1946-2011,2188-2309,2344-2393
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000139
Family Galacturonase 0.048
Further Details:      
 
Domain Number 8 Region: 296-353
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000314
Family Galacturonase 0.066
Further Details:      
 
Domain Number 9 Region: 1436-1609
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000387
Family Pectate lyase-like 0.07
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|319425|NCBI_GNO_2900124
Domain Number - Region: 402-479
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000152
Family Spermadhesin, CUB domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|319425|NCBI_GNO_2900124
Sequence length 2908
Sequence
MKPGRFHITKWPTTTLLAVSCFLVILCHHRTVSESIFNPSVTDSQFMTRAHSPYHIRDVI
HIEKTGSLNIESGVVINFHPGAGILVKGALIAKGNADARIVMNAMETGPARSLPDVRLVD
GPTPLSGRLQINHLGEWRSVCTNSRNWTVTDYETTCRQMGYTGGRYVQWMDRVNSSSSRP
LLLENPRCYPGGSSLFQCDWNSRRVGAGVCDYHPDLGMECSGYYSAESGLVGSRWRGIRF
EHARHKKDLTQGNTLYVKMSESYLHYVDILNAGVDRDGKIVSALESVGVAPQMDKLRVEG
SAYNGINVTSPDSPVVMRGATVTGNAGYGIYVNTSSGSVLLDACTVSDNGQEGVKYVFHD
TRPGDQSGDAVVGTHDLCTSASTSNPVYPLPILAESYHESIANARCEKRFTSTLGQVLTL
HFVYLMADKPDAMADVVVHDGPDSRSPLIAKFSITNSTRPQSVTTTRNAIWILYTARASS
RTVLQMELTSGFSKSYDLNLTNSVVTSNGARGVLAENIRSLLHVQGSTLRENRMAGVQVL
DGAGDVNVTSSFVGYNWGDGVNMTYSGGRVNVSYSVIESNRGHGVVAWFNQSSLKLALNQ
EFIIAYNTLTANQWTSVMVGNFCTAGSVNVSGNIFNQSQWNALEILSCWNPSTPMRQIHV
GHNQFHHNQRVGFVMSPAVSMMAVIEHNLFRNHQQGCLLIRNPDALELESLSSDVLVINN
RFEFNSGLFVANLGLSQYSGDAQKLFFTRNWIKRNSIRQPFSSVGLHPRSRVAAVVVVGS
SNVNVTRNMIDNPDSNYEIGSQLEDQQLEISAVRNWLGGKAERHIYYRLFDRKDRYNLAR
VAFKPFLLHDTNFDTDAESNIQDFVPTFVTPGSREIGGEVTGQEELIDPGVYHVTRDIVV
HPTGRLTVAFGVTLRFEHSLGMMIGGELVAEGSTSTDGSITFSLMDRALRENTTVEVPVR
LVGGASNGEGRLQVKIAGRWGSVCNEGWTRQSAAVACHQMGLILNPRDWFIDSSQLQSSI
GLEDPVLMSHVDCSVLDTDVRSCFHRPTVNQTENYCGHDMDVGLRCHDVSWAGLRFGMTA
KKSVLRSATVERAGLFDYATHSFQPAVRIDFHHHVLDRLRLVGNDHDGLGIMYSDIYYPE
RIPSLKNSHISQNRGHGVSLRSLGLQLAECHIEDNVESGIHYNPMIARQELREMVGWLSI
LKANKFILIPETKGTLELVPDEPRYLKTSRLKAKEEVESTLIIQTDQRNVIGMQVINPIQ
NSSTESVLLLDYGDLSNEVWNVRVNLTSFPTVSSSYKLTIKYKSGQDAKGGMLILLTAYR
RTDLQVQRSRLLTGPIPMLSISSTNIRRNGKGLSSLHYNLFLSPGGNHHYLRKANETIQL
IGCEISQSKEEAVLIHTPFRDSGRHPLAEIKYIMNYTTVADNQRAIVQNGRDLRDSNNLF
HWILQNDTIRNNRGGGFDIRLPYVLQYNENYTHSVYVADSTWTANRQFGMVVGGHFARLN
MTDNILEDNEGQPGLISFRGMEKEMFILRNTVRRNTGNFMVEFDMDSQSEILGEVSAYFT
RNVVKDNGHATRSMMSNPHLAASYAVALKGVQKVNVTDNMIGPNTAMDYELLAGIRSSRL
DNFVNVQRNYWGTPELEHIRERIFDFDDWNSYAIATFRPYFLEPTWDGGQSVFSDILPPM
MDVERLGGRLFQDLVLLRRDRPYIVHTDLTVMPGVTLTIMPGVELEFFPSVGILVLGVLH
AEGHWEAPIRMRPAAQNSAMTVNYRLTRQVTAGQDDNVRLCLEGQCLPGARQGYLELYNR
TTQQWVPVCDRRFTEQNARVVCRQLGLDTFHEYKSFGRRWEFQLATLSRVRHWPEPIQCI
GTESRLDDCDIRLNGQVWDHIYSCPWDSEEFVFVDCGNRTSEASPSYWGGIRFSVSSFED
NLVELRSGLPVHLDPNLERHSRLYYVHITGAGILHGERSPAVLSVHRTPTIQQVNITHCA
SDGISLVSPSLNLPLLDNRVEYNGGIGLSVLMLNGETRDADLSAFSPLRFARGLPYNTFG
ILDACDPGKQVIVEERILVYYRYENRPADCVKIFTSRYGVKTFGFRLLQLNLVNSTNQPW
DPDSLTLYDGDIYNITSTVIAQIVSTTTGPAMENRLYRSKKPSLSLKIHSSGDDGSYGFI
AEVITLPIAAIGFGRDIRHNISFSGFFHNRAGAVYYSSAGEINPILTMEWNQIVDNGAQL
YGNFSTSEAAVALDVQNMDSLLFRNNLIRRNQGGLKIQSDSNGVPTALKAVIHNNVFADN
NVTETVYLQGRRSSPYQEVTLYHNYVTRSNVRYKNVMLLDQVVANLTENHIFNNLGYHIM
EVYGFGRVRLPIYQTFYHNSFHKNYAMDRDSRGTVIAGSSGQRYINNVFYNPDNDYEMIA
LNWTGLEMQRTAIEAGTNWWGYNTTTAIVGRIRDFRDIPELLQVRFEPYYLNNRTVLSGK
CDPGWTQVGDTCYVYIGVPMNFSDAKEFCKKDNASLPYLMNNYYGVMEFLISQQVGFDYY
ARVWVQHLDMIGQCVVFVNRRVERSPCDLLLPFLCEADPHVVLDPLGWTDDALTVALLGA
SAAALLLIILCVAFWASKSKHRAEERFERRNSIRGSIRSIRSFNSLASSSGFLDTAGARR
KPLVPPSARNGGSVDSIAKSQFESSVEDNRSYSIYDAEEHPANTVGLPQPPQQGFSYSQL
DHRVNRPAGQTAVVNHHPNGGQLTFENQGFRDTSTYASHPESRPPSDMWGDSYSIDAQSN
ITTSVSVHHHNGAVSYHPQPGRSINEPDYSRIRSRSEAGVMDNYSTASVITDSTLAMKRE
LDDSDAASAVTLPQSRPRPDDASGQNKMQPLINRPPMTTRSQTLLETNFDTGVPEVPRHA
VTTGYLASSNEHFFLPHRSKSTPLETDM
Download sequence
Identical sequences E9GLP3
jgi|Dappu1|319425|NCBI_GNO_2900124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]