SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|319571|NCBI_GNO_3000052 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|319571|NCBI_GNO_3000052
Domain Number 1 Region: 67-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|319571|NCBI_GNO_3000052
Sequence length 222
Sequence
MAASPMITSESTSSLLRNRQHFLRLRLSVAAVLVMTTLLMAGSGDAIDLMKLLDQKQRSF
KRAGEPCHPYEPFKCPGDGACISIQYLCDGAADCPDGYDEDLRLCTAAKRPPVEETASFL
QALISSHGPDFLEKLFGAKARNALEPLGGVERVAIALSESQTIGDFGSALRLMRSDLEHL
RSIFAGIQSGDMTALASLGIKDAELGDVKFFLEKLIKTGFLD
Download sequence
Identical sequences E9GM59
jgi|Dappu1|319571|NCBI_GNO_3000052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]