SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|319716|NCBI_GNO_3100013 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|319716|NCBI_GNO_3100013
Domain Number 1 Region: 256-452
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-40
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 190-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000733
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 3 Region: 108-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000171
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 4 Region: 31-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000402
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 150-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000805
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 73-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000958
Family EGF-type module 0.019
Further Details:      
 
Domain Number 7 Region: 497-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|319716|NCBI_GNO_3100013
Sequence length 572
Sequence
MGTKGYNFLQTISKLQFKKGNCTGKISNEVLAKCDTCYTFPCKNGATCRPTGERDYECLC
APGYHGKLCESAIDACYGNPCRNSAICKVLEEGRFSCHCSAGYEGDRCETNINDCLDHKC
VNNATCVDQVESYRCDCQSGYTGIYCEKKIQFCTKDFNPCKNGATCVDRGDHYACQCALG
FSGENCTVNNDDCISHMCQNGGTCVDGINEYTCKCPPEFSGKFCEASPMVSLLYPQTSPC
QQHDCQNGICFQPQGLTDYICKCASGYTGKRCEFLTSVSFAQNGSYIEMPSLKTKPEANI
TMIFSTEEENGILIYNGESQHIAVELFRGRIRVSYDVGNYPVSNMFSYETVSDGRYHTVE
LLSQKKNFTLRVDQGNARSMINEGEHEYLRLSTPLFIGGLPNEAAEKAARQWQLRNTTSF
RGCIKELWINGKLTDYAQAATKQNRIIPGCANSESEETAAEMIKPKANNLKKDNAQREVK
DSAAQPQSYMNTLKTSVLTSYDPCKDHRCRKGQCVSKKDGKNYSCKCQAGWGGKYCDTVI
RKTTKMLDNYQSATFLSQAVLLRSYRPYLIVP
Download sequence
Identical sequences E9GMK8
jgi|Dappu1|319716|NCBI_GNO_3100013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]