SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|320142|NCBI_GNO_3300158 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|320142|NCBI_GNO_3300158
Domain Number 1 Region: 952-1252
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.53e-44
Family Complement components 0.00029
Further Details:      
 
Domain Number 2 Region: 1331-1458
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.000000000275
Family Alpha-macroglobulin receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 642-675
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000537
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|320142|NCBI_GNO_3300158
Sequence length 1521
Sequence
MRQIPASVTNGRYRLKLEGYDTLHPQKAVFIKESQLDFHSDFLSIVVQTNRKVFRNGMKV
RFRVILTQLNLKPYTDPITVFIVNPQGFIMRRWPSRNPRNGVATMSYDVPSYPTMGNWTI
RVEAMQQVHEHQFVVERYYIPFFEVIPSAPAYVLDSDDKYTAGVTTSFHRARVANGNTTV
QVHARPINTTLRAYRLVSEEHPPWIVIHLARLCWLQTHEFSYEVDLNDVRSAMGTKSLAG
WVIRVTTSVHNYFMGETRRSFIETRVIRAQLKFKFSGAKTAVFKPGMPFEGHVYVMYDDD
QALSPEKLAAATLTIRPVVTTSNGQLKTLPEVIVPATGEYLSNPKGASKKKYGADFKQWM
ERQAEDAEFGQFRRTGVYHFRFSVPKDANAIKITATYKDGQGDKATAEMRAVAFYSANEM
YVHVGTSTEQGRLGENAVIHLRSNFGFQVYSYVVASKGLVIHGATETHPHPTKLVTFSVP
VSSEMAPTFKLVAMIVSPVGELVADSVTIPVQSFNRYKVNVTTVQVRDHSKETVQLVTRT
RPGAFVGVSLLRTINYIFQADNALTPSRVLKALYKLEPFTKSVHGVTWTDREGLKAERTE
YFKGANPGADTKRTFDLAGLLLFSDARISQYPDIANCDQSNGYEPCLAAGCFHKDRRCDG
KADCTDGSDEDDCPPAVDDKMNFRIFRRSRYHDFYDWLDGDWAWYDIPTTDDGIEFHDRG
IAATDESWYINAFSFHPEFGFSMMDEVVAYDGSPPFYFSVESPSAIRRGETLGVRLMAVN
NLKEEVMTLIVLEASDDYLFVETGDDGEVEHYRPKLVSGERQHMVAIKAQSYREVYLPIS
PQVEQGTITIKIQTISQIRRQTFQIDLDILPEGATVTRYTSLLLDLKNRAHVLRYLDIPV
EESPVIPYSKFRRYVFGSPRASVTLCGDVFGPVFPSTPISTDSLLSRSLHGTKANLYNLA
STLWSLHYLRLTNQLKSRVLYRGLNTMNIQMAELMRLYNYDGSFIAQKASDPSIWAWVIR
VLGQSQFQDWENHFFVDRRLLGTSVQWILKNQNRDGTFEEPDDYPFPLEIQSVRNATRKV
ALTAHVLIGLHHCSESLEGPLKVLTATAKARSVNYLERAVSRLTDPYEVAIVTYALTLAN
SPAKESAFNGLHKIKRESDGMVYWSREPVPSNQILYENQRPFLQPRLPMHQDAVAVEATS
YALLVYLARDGIGDLQERVVSWLNTMRMVDGGFVSIYDSIVAMEALTEYAYRARLRDITD
MSVVVEASASKMGKTMRINSNSLANVHRMNIPNVWGHVNIIGRGAGQAVLQLKVQYGIDW
EELNDVPKRRYFDLSVDETYSHFRNKSHVTVEACIRWLATDEAKTSGPTTLEVETPSGYG
FVQSDANELVIKNNYTFIRDVFIGRSKIIWVFDRVGEERLCIKYHVHRWFPVANMTLYRE
AVVYESHMPEHFEMIIFNATPLYVLDICEVCGSYQCPYCPYFSGSPVSAKLSSPLLVIFG
SLLANAFVHYLVHRHQFRPTL
Download sequence
Identical sequences E9GNZ3
jgi|Dappu1|320142|NCBI_GNO_3300158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]