SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|320144|NCBI_GNO_3300160 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|320144|NCBI_GNO_3300160
Domain Number 1 Region: 1012-1318
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.66e-46
Family Complement components 0.00011
Further Details:      
 
Domain Number 2 Region: 1407-1527
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.00000000000876
Family Alpha-macroglobulin receptor domain 0.007
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|320144|NCBI_GNO_3300160
Domain Number - Region: 705-737
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000124
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|320144|NCBI_GNO_3300160
Sequence length 1582
Sequence
MIMLIALMINEWCKRNFVVTASAVVRPDTVYRVHIVVLPGAPDLVFKALITKGNGQHVAS
GSSYTIDAGTSSNLLLKIPASILFAGDYRLKLDSFDPLHPQQPILIQESPLVFHSDFLSI
IVQSNRKIFANGMTVRFRIILTQMDLKPYTDPITVFILDPQGFVIRRWPSRNPTNGVVSL
TYQLPSNPSVGSWTIRVEAMQQVHEHQFGVEHYYIPFFEVMPSAPAYVLDSDETYTVEVT
TSVHTQFVANGNLTVHVYARPVNSTANDYQLVVEELFPWNYEFTYDVDLGQVKSAMGSNS
LVGWVIRVTTVLHSYFMGEARDGFIETRVIGAQLKFKFSGAKTAVFKPGMPFEGHVYVMY
DDDQALTSDKLKGATITLRPVVTSTNGQTKTLPEIVVPAKGEYLSHQQQENANKYSKEYD
NWMEHQIEDVKFNQFRTTGVYHFRFSVPKDATSMRISATYKDGDGDKATAELQAVPFYSA
KEMYVHVETSTAYGQLGENVVIHLRSNFGFQVYSYVVVSKGLVIHGATETHPHPTKLVTF
SVPVSSEMAPTFKLVAMIVSPVGELVADSVTIPVQSFNRYKMNVTTVQMRDHSKETVQLV
TRTRPGAFVGVSILRTVNYVFQADNELTPSRVLKALYKLEPFTKSVHGVTWTDREGLKAE
RTEYFKGANPGADTKRTFDLAGLLLFSDARISQYPDIANCDQSNGYEPCLAAGCFHKDRR
CDGKADCTDGSDEDDSKLQVLERKTEWNFATCAGADFYDWLDGDWAWFDVPTTDDGIEFQ
DQEVAADDEIWYINAFSFHHELGFAVLDEVIVYDGSPPFYVLAESPNSVRRGETVSVRLM
AINNLKEEVMMLIVLEASDDYLFVETGKDGEVEHYRPKQVGGEHHHMVAMKPESYQEVYL
PIAPQVEQGMITVKIQTHTQIRQQVFQIDLEIMPEGATISRHTSLLLDLKNRAHVLRFLD
IPVEESPIIPYSKFRRYVFGSPRASITLCGDVFGPVFPSTPITTDSLLGRSLRGTEATLF
NLATTLWSLHYLRLTNQLESAVLYSGLNDMNVQMAELMRLYSHDGSFRAHTNSNPSVWVT
AWVIRVLGQSQFQDWENYFFVDRRLLGTSVQWILSHQANDGNFEDPDEYFFPLALRSALP
NNATRKGSLTAYVLIGLMKCRESLEGSLRVTTAIAELRAINYLERAISHLADPSEIAIVT
YALSIANSPTKEAAFYLLHNIKREGEGMVYWSREPVPSNQILYENQRPFLQPRLPMHQDA
VAVEATSYALLVYLARDGIGDLQERVVTWLNTMRMVDGGFVSIYDSIVAMEALTEYAYRA
RLRDITDMSVVVEASASPDATELMKINSDTLATVHRMDIPNVWGHVNVIGRGAGQAVLQL
KVQYGIDWEELRDNPKRRYFDLYVEESYSHFRNKSHITVDACVKWMATDEMRTSGPATLE
VEMPSGYELIQSDANELVIRNNYTFIRDVFIGRGKIIWMFDRVGEERLCIKYPIHRWFPV
ANMTLYRTAIIYESHIPEHFEMQVFNATPLYVLDICEVCGSYQCPYCPYFSASLPTFSSP
FLIVCSLVAIALAYFYRPHSFL
Download sequence
Identical sequences E9GNZ5
jgi|Dappu1|320144|NCBI_GNO_3300160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]