SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|321251|NCBI_GNO_4000006 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|321251|NCBI_GNO_4000006
Domain Number 1 Region: 17-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000029
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 2 Region: 85-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000012
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 155-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000308
Family EGF-type module 0.025
Further Details:      
 
Domain Number 4 Region: 123-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000457
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|321251|NCBI_GNO_4000006
Domain Number - Region: 2-24
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0721
Family Complement control module/SCR domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|321251|NCBI_GNO_4000006
Sequence length 193
Sequence
MTLQCLHNQQWSTVKGHCKRVHCSHPVAKGTASVVVISGEADAGSGQYHFGNRLLVTCKH
GRHLKGSSTILVCQADGQWTGQPPVCESQCDTVCLNGGSCNSNNRKCTCQPGYSGDRCQH
AHCILPCLHGGTCIAPYRCACRPGRTGERCQTPVCDQPCLNGGRCVSPNVCTCPHGTVGP
SCRKRSDIFSSRG
Download sequence
Identical sequences E9GSD3
jgi|Dappu1|321251|NCBI_GNO_4000006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]