SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|321711|NCBI_GNO_4200089 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|321711|NCBI_GNO_4200089
Domain Number 1 Region: 732-783
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000167
Family Laminin-type module 0.0093
Further Details:      
 
Domain Number 2 Region: 944-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000053
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 3 Region: 835-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.00042
Further Details:      
 
Domain Number 4 Region: 285-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000368
Family EGF-type module 0.094
Further Details:      
 
Domain Number 5 Region: 448-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 6 Region: 401-450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 7 Region: 890-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000314
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 8 Region: 992-1037
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000314
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 9 Region: 346-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000558
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 10 Region: 788-837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000787
Family Laminin-type module 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|321711|NCBI_GNO_4200089
Domain Number - Region: 695-734
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000607
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|321711|NCBI_GNO_4200089
Sequence length 1626
Sequence
MSVVSLLASLLLVTSQAVTAQSQLIGSDDGTNQQSGNRCIDDEQNPQRCIPDFVNAAFNG
RVEATNTCGLYGPSEFCTQTGAKGPEKSCDICDARVSHLAHPADYLTDFNNNDNITWWQS
DTMLEGIQYPTQVNLTLNLRKAFDITYIRVKFQSPRPESFALYKRTSEDGPWLPYQFYSA
TCRDTYGLPDSNFVRRDDEKRALCTSEFSDISPLTGGNVAFSTLEGRPSAYNFDESKELQ
DFVTATDIRITLDRLNTFGDEVFGDPKVLKSYFYAISDFAVGGRCKCNGHASECVSSSSE
DGSYSNLVCRCEHSTAGRDCQECLPFYNDRPWARATADDANECLPCNCNGFSSRCYFDQA
LFDATGHGGHCLDCTANRDGPNCERCREQFYQREDNYCVPCNCDETGSRSLQCNREGKCL
CKPGVTGDKCDRCEENFYDFGPQGCRPCGCNVAGSLGGQPRCDSETGSCSCKDHVEGQRC
DRAKPGYFNLDAENLFGATPCFCYGHSSVCRSATGYARGLIESVFARSDEKWSALEQPGN
RPITLAYNSLLGNIGVSAPGRDAVVFSAPERYLNDQRTSYNQQLHFTLRTNEAGARASID
DVVLEGSGLTISQPIFGQGNQLPSASNQVYSFRLHEHPDYGWNPRLSSRDFISVLANLTA
IRIRGTYTPRGAGYLDDVKLETARRGGSGSPANWIERCNCPEGYVGQFCESCAPGFRHEP
ANGGPFARCVPCNCNGHADICDAESGRCICQHNTAGDNCERCARGFYGNALQGSPNDCNP
CPCPNGGACIELADETVVCLECPVGYAGPRCELCSDGYFGDPEGRFGTRRPCQPCDCNGN
VDPNAVGNCNRTTGECLKCIYNTAGYRCDSCLAGFFGDALALNKGDCRPCQCFRRGTLQL
PSGTLQCDQVSGQCECKPNVMGNNCDRCLDGFFDLESGNGCQTCNCDPVGALNRTCNVRN
GQCFCRPGVVGLRCDSCAPNQFGFSYDGCKPCECDTIGSLSLQCDDPDGQCRCRDNVEGR
RCDRCKENKHDREAGCKDCPPCYNLVQEAVDQHRAKMADLATILQRIISNPTIIADLDFD
RKLAEVQDRVDQLWVDAKMQSGGDKSISIQLEELKNRLKQVQQMTGEIEMRTQSSRRATA
AGVGNLTVAEAAVERARESLKSAQRYLETEGSDALQRAIQRSEKFGQQSERMSQIARDAR
QAADTLDDAAALIESTAQEALNTSSSAYQLAREAVDQQKNSTEEIGGLRKELTITEQTLA
RTRAMAKEALTNAQSAYTEALSLLGDAYSLVVPNVEWQFMKRQAAQHSEESLQIKAEADQ
LAAENANMLDEVSDQIIGAGDVLAKGVAQQQIADELLADADVALGRSQEAVSLGEKTLAE
AQKTLETLEGFDSLVQESKEKARDALGQAVEITNLIEQAEERTREAQNALAGAESDARVA
RDSAKQAQEHAEQASKDAVMIRQGASETRDKAGQLKDTAESLTANVADTANRMRTLEAEA
AEDQGLAKEALEKANQAKSISADSTVKVREAISSVNEILISLNNMGNIDTAALDELERKL
IIAERDFIESDIERRIEEMRTARVTQNQWVRDYEEELARLRLEVDNVEAIKEALPEGCWK
RLKLEP
Download sequence
Identical sequences E9GTN3
jgi|Dappu1|321711|NCBI_GNO_4200089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]