SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|322353|NCBI_GNO_4600109 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|322353|NCBI_GNO_4600109
Domain Number 1 Region: 62-191
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-23
Family C-type lectin domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|322353|NCBI_GNO_4600109
Sequence length 192
Sequence
MQAFSFPGIFVCIVGVLLFKGQVSEQLAVIQQESGSDMIPADQTTLIEDKTEVACQGSIG
TNKCIKTNGVCYCFVPQQLPWLKAYEFCNSYRKNLISIQSSTDQQVVTQFLMPLILNDPV
AKNIGVWTSGASVPGLKTYFWVSKLSLFFYSNWFYGEPRPTSLSECVRIAPVPEGPWAST
PCEQWLPFVCQD
Download sequence
Identical sequences E9GVN7
jgi|Dappu1|322353|NCBI_GNO_4600109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]