SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|322426|NCBI_GNO_4700030 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|322426|NCBI_GNO_4700030
Domain Number - Region: 78-132
Classification Level Classification E-value
Superfamily HMG-box 0.000249
Family HMG-box 0.0082
Further Details:      
 
Domain Number - Region: 2-33
Classification Level Classification E-value
Superfamily HMG-box 0.00105
Family HMG-box 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|322426|NCBI_GNO_4700030
Sequence length 150
Sequence
MAKSLEERWMKLSEGEKEPYRRLMEKRNNVIEEEIKILDNIIIAKRPGRRSYSGEKLTVR
IPEKEKPMEDKMGLNPIFWFFCDDFRKSISDNPNWCNNIMEMQTRTVKKWSTLSKEIQGD
CIHRAKNQFEFYTGSTDGNEVVDHNLLITL
Download sequence
Identical sequences E9GVX6
jgi|Dappu1|322426|NCBI_GNO_4700030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]