SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|324336|NCBI_GNO_6100063 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|324336|NCBI_GNO_6100063
Domain Number 1 Region: 284-342
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 8.37e-18
Family Tachycitin 0.0082
Further Details:      
 
Domain Number 2 Region: 54-118
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000471
Family Tachycitin 0.019
Further Details:      
 
Domain Number 3 Region: 122-192
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000133
Family Tachycitin 0.04
Further Details:      
 
Domain Number 4 Region: 199-256
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000011
Family Tachycitin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|324336|NCBI_GNO_6100063
Sequence length 371
Sequence
MLRSPIVLVILLVCIQACIANEEWKQLHRKQPQGQHSVVNAAAAARDINLGESDFQCPTG
YVVYPDTQCNRYYTCYGGQPTYLMQCEADLLFDLTYYGCNWKEQVDCGDRVPPGQVTTTT
QTPIGNITCPEANGFFAAYPDYCDPNYIECLDWVPYPAKCPANGVFDPISQVCVSPDSPA
CTKYTTTPSTTTPRITTTTAAFQCPAEDGFYPISETTCSSNYYACLDGNAYLETCRGYSV
FDPIQRICTTNSSFCGVITSPTASLTSTTSAVATPTTTKPSGTSAPFTCPSPNGNFADPN
SCNQYYQCSNSNPNLFVCPAGLVFNPAIGTCDWPYNVPGCEGGSSDQAGSQQRNKFGGKN
ARISVDKAAKI
Download sequence
Identical sequences E9H1M0
jgi|Dappu1|324336|NCBI_GNO_6100063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]