SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|324340|NCBI_GNO_6100067 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|324340|NCBI_GNO_6100067
Domain Number 1 Region: 85-139
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000248
Family Tachycitin 0.054
Further Details:      
 
Domain Number 2 Region: 28-88
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000288
Family Tachycitin 0.064
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|324340|NCBI_GNO_6100067
Domain Number - Region: 142-171
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0191
Family Tachycitin 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|324340|NCBI_GNO_6100067
Sequence length 186
Sequence
MERWLQFILILVITQGYSCAILKELPTVPLEFTCPAEEGFYSLNNQCTTDYCFCQSGVEI
RCQPCPEPQLFDPESQTCVEPAYCFECPADEGKYPVPQQCVGDYYECTAGYPQKLTCPND
YIFDPATYECVPSGEATCMAPFDCGENGYYTYPDSCSGLYFLCVDGTSFPMVRELIMMAI
FEQLNI
Download sequence
Identical sequences E9H1M5
jgi|Dappu1|324340|NCBI_GNO_6100067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]