SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|324586|NCBI_GNO_6300040 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|324586|NCBI_GNO_6300040
Domain Number 1 Region: 435-960
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 8.32e-133
Family alpha-mannosidase, C-terminal domain 0.0000000151
Further Details:      
 
Domain Number 2 Region: 13-333
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 7.12e-101
Family alpha-mannosidase 0.0000000111
Further Details:      
 
Domain Number 3 Region: 335-430
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 1.28e-26
Family alpha-mannosidase, domain 2 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|324586|NCBI_GNO_6300040
Sequence length 963
Sequence
MPCGERRIHQRSPHTHDDAGWLKTVDQYYYGARSQIQEAGVQYIIDSVVDELKDHPDRRL
VKKFLHLSTWKWPFFTRWWQEQTETTKALVRTLVNEGRLEFINGGWCMNDEATAHYVDII
DQMSFGLITLNDTFGECGRPRISWQIDPFGHSREQASLFAQMGYDGLFFGRLDHEDKKER
MAKKTMEMVWSGSDSLGTQASLFTAVNYNLYQPPPGFCFDIYCNDEPIIDDPRSKDYNVE
KRVTDFLNYCQEQANAYATDSILLTMGSDFHYQDANVWFKNMDKLIKYANERQATGSRFN
LFYSTPSCYTKALNDHAKTWPSKTGDFFPYGSDAHAYWTGYFTSRPASKYMIRQGSNLMQ
SCKQMDAALVRQGVATNQVGELFTMKDAMGIMQHHDAVTGTEKQHVAEDYALLLHKGVVE
CQKIQTAYYEKELVIGNQVLPKVSYCQLNVSQCDPTEKNNRFVVNIYNSMARSVDKYVRV
PVASGTIFQVHDPQGNVVASQTVPIAEYVKSLPGRVSSATVELVFLASQLPPLGSKSYYV
QPGTSKDEHEPQNKFAISNEKVSVEIDDVRGLIKSVTVNGKTTELKQEFLWYPSKSGDNS
VADKRASGAYIFRPDSDGAFAIPSSGITTTTYSGELVEEVHQIYNPWVAQTIRLYKGQEH
VELDWVVGPIPVEDGTGKEIINRVTTSIASSGMFYTDANGRQTLERRFNIRDSYPYTVTE
PIAANYYPVNSHAYIKDAVGNQVTMLVDRPQGGSSLHNGELELMVHRRCLYDDAFGVGEA
LNETAYGDGLVVRGTHFLILGDKTNSMKMARSLSHELYKQPQISFIPTSLSFSEWSALYK
TQQQSLSRTLPVNVNLLTLETLNQGKYLMRLEHIYDVGEDSILSQPATVSIEGLFPGFTV
TSSEETMLGGNQFKKDSNRLVWNVASTSNRNENGQQIWDERAIPAVQLKPMEIRTFIITL
VRI
Download sequence
Identical sequences E9H257
jgi|Dappu1|324586|NCBI_GNO_6300040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]