SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|324591|NCBI_GNO_6300045 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|324591|NCBI_GNO_6300045
Domain Number 1 Region: 440-965
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.1e-133
Family alpha-mannosidase, C-terminal domain 0.0000000149
Further Details:      
 
Domain Number 2 Region: 10-338
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.56e-112
Family alpha-mannosidase 0.00000000479
Further Details:      
 
Domain Number 3 Region: 340-435
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 9.48e-27
Family alpha-mannosidase, domain 2 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|324591|NCBI_GNO_6300045
Sequence length 968
Sequence
MKIVSYIIWTCPAEKEGFINVHLVAHTHDDAGWLKTVDQYYYGARSQIQEAGVQYIIDSV
VDELKDHPDRRFIYVEMAFFTRWWQEQTETTKALVRTLVNEGRLEFINGGWCMNDEATAH
YVDIIDQMSFGLITLNDTFGECGRPRISWQIDPFGHSREQASLFAQMGYDGLFFGRLDHE
DKKERMAKKTMEMVWSGSDSLGTQASLFTAVNYNLYQPPPGFCFDIYCNDEPIIDDPRSK
DYNVEKRVTDFLNYCQEQANAYATDSILLTMGSDFHYQDANVWFKNMDKLIKYANERQAT
GSRFNLFYSTPSCYTKALNDHAKTWPSKTGDFFPYGSDAHAYWTGYFTSRPASKYMIRQG
SNLMQVCKQMDAALVRQGVATNQVGELFTMKDAMGIMQHHDAVTGTEKQHVAEDYALLLH
KGVVECQKIQTAYYEKELVIGNQVLPKVSYCQLNVSQCDPTEKNNRFVVNIYNSMARSVD
KYVRVPVASGTIFQVHDPQGNVVASQTVPIAEYVKSLPGRVSSATVELVFLASQLPPLGS
KSYYVQPGTSKDEHEPQNKFAISNEKVSVEIDDVRGLIKSVTVNGKTTELKQEFLWYPSK
SGDNSVADKRASGAYIFRPDSDDAFAIPSSGITTTTYSGELVEEVHQIYNPWVAQTIRLY
KGQEHVELDWVVGPIPVEDGTGKEIINRVTTSIASSGMFYTDANGRQTLERRFNIRDSYP
YTVTEPIAANYYPVNSHAYIKDAVGNQVTMLVDRPQGGSSLHNGELELMVHRRCLYDDAF
GVGEALNETAYGDGLVVRGTHFLILGDKTNSMKMARSLSHELYKQPQISFIPTSLSFSEW
SALYKTQQQSLSRTLPVNVNLLTLETLNQGKYLMRLEHIYDVGEDSILSQPATVSIEGLF
PGFTVTSSEETMLGGNQFKKDSNRLVWNVASTSNRNENGQQIWDERAIPAVQLKPMEIRT
FIITLVRI
Download sequence
Identical sequences E9H264
jgi|Dappu1|324591|NCBI_GNO_6300045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]