SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|325447|NCBI_GNO_7000066 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|325447|NCBI_GNO_7000066
Domain Number 1 Region: 88-229
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000569
Family 28-residue LRR 0.04
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|325447|NCBI_GNO_7000066
Domain Number - Region: 501-527
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0025
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|325447|NCBI_GNO_7000066
Sequence length 530
Sequence
MPQKKSAGSLKAICLAYISRNMDKFCNGTEISEQVDDADAIGVGENTTNPIHQLPSVLLD
LLTEIITQRIKLVDVTQAEKFLHQIITPCLSTLDLSLYSLRSNFHYIFALASVRCKHLKK
LCLDDCSFCNSDFLDFIPNFSNLQVLNIESVINIKFTLSGDDLFHFLGKHCKDLRKLFAR
DNQVSDAGIHGLCVVGNCKLLRVLCISRNPITNRGIRMALDNLPLLKILSHESLVEENDG
INPSGKIEATLGENNLLQIEWTPRSIDCIKFSSGVWIRVYDSSQKQPSTGENYLAIPQKC
LKRRANASFSIALPSSASKFSGKTCHFELNDVLIQCRVYTIEVVPNYQSLNRKALFTEIV
IPPANDNSTKSLESLISVESNSSLFTLKWKDNSGCTPQLTSLYLKIFPDGMENAGNATMS
LQIPRNCLKQPTEETNVFSLSLPENQTYCPVEWVPLDPCRKYKIEIKSEYSNTWTRAPSL
WETFTEERVFTQMNPSHNSYDCSSDQFNCDNICRPYGWICDGTRDCNAYI
Download sequence
Identical sequences E9H4R7
jgi|Dappu1|325447|NCBI_GNO_7000066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]