SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|325481|NCBI_GNO_7000100 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|325481|NCBI_GNO_7000100
Domain Number - Region: 39-86
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00165
Family Hairpin loop containing domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|325481|NCBI_GNO_7000100
Sequence length 120
Sequence
MYSLKIKSLPSIFLMVVMFMLATASARVWNYAEGNQVRWSGNCNFRGYDFQTVFVPNDRC
GRACLDNSFCTHFTNTRTTCFLKRNLDGWREQFSRNEDCGFIPARTKQSTEPRDTTDTDN
Download sequence
Identical sequences E9H4V0
jgi|Dappu1|325481|NCBI_GNO_7000100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]