SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|326443|NCBI_GNO_7900097 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|326443|NCBI_GNO_7900097
Domain Number 1 Region: 754-858
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-28
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 2 Region: 538-606
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000798
Family Spermadhesin, CUB domain 0.0077
Further Details:      
 
Domain Number 3 Region: 624-728
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000196
Family Spermadhesin, CUB domain 0.0078
Further Details:      
 
Domain Number 4 Region: 461-495
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|326443|NCBI_GNO_7900097
Domain Number - Region: 418-457
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000877
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|326443|NCBI_GNO_7900097
Sequence length 859
Sequence
MAWFRFLLVHCLIVFVRSEVESENHEEPTATASAFCNTECNQQLQNRLETIEAAIRTIVS
AVSGQTDDIFSPIKEIFQQDPSVRSILSLNFTSTIESISGNSTLKINSVPLAQGNAHGNQ
PAAETAVDTLKGAVKCSLAHLVDINTTDYIDSSNSSTDAAVVASLFNESLDITWPILSAE
CLKFSSGVWIRVYQQAPEGDYNLQPETSLYVPQKCLKKNFETSYSIVLLPSSSNEKNNSC
AFSLARNLIQCRVYVIEVIPNFQSLRGKTLRTEIVVPPKIKKTDEADFRSLISVAAHSNS
LLLNWEDNSGCSPQLTSFTLKIFQDGIVDKVERPNMTVTIPRSCLKRSANEDNLFSLVLP
ANQLTCPIEWKPLDRCRKYRIDMSSKYSATWNGPSSSWEIFTEQSLSNYTTEVSDVMWRC
PKKHFMCPYNYNCISSDHSWVCSGGIECSHRRDEEYCDQSVCNKDGFRCGRQCVPKELVC
DGKHDCLDGSDEDDCSTNVKCEQLTNQSGHFSSEIFTKPAAEIHPERISDAVRKTIVLIS
VQSNHQIWLTFDKFTTVINQDFLKVYDGPYSTSPLLLSHSGPTKPPSVRSSSNELFVEFP
SHYDIDYKVEGSYASIKGTDESFEPGCGGYLNGEGTISTPNYSSDTGIADCYWLIGSRQS
DDLILLRRNPSDVKHPTAAFFSSRTYPEMIVYDGWSTDGLVLYDTKSTESQQKTVVYSVS
NKMMVHFKPPKIKENHISYWDVFKISTPQCKNYLEGTSGTIKSPNYPMPYPHLTDCRWTI
SVKPGSKVRLLFAFFQTQQGADFISVYDGPTVNEKLLLSESGSVPTPFVVNSSTNQVLVR
FTSDGDTSLSGFLAVYLSL
Download sequence
Identical sequences E9H7S2
jgi|Dappu1|326443|NCBI_GNO_7900097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]