SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|326593|NCBI_GNO_8100035 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|326593|NCBI_GNO_8100035
Domain Number 1 Region: 61-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000127
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|326593|NCBI_GNO_8100035
Sequence length 154
Sequence
METHAEMERELEEKPKLLTNFIRLGIQRIKKFDCWGISVGIGDFKESINCNRTEELNRLR
TSAVVQSPFLPRPYPNGITCITDLSAPLGFKILLNFEFLDLEEEEDCNYNVLDLQNLDEI
LIFDERRDSSVTPWRRCGNWNSRYKLLQWRSNGN
Download sequence
Identical sequences E9H875
jgi|Dappu1|326593|NCBI_GNO_8100035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]