SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|327753|NCBI_GNO_9400063 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|327753|NCBI_GNO_9400063
Domain Number 1 Region: 155-461
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.73e-28
Family NodB-like polysaccharide deacetylase 0.022
Further Details:      
 
Domain Number 2 Region: 107-143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000105
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 33-91
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000173
Family Tachycitin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|327753|NCBI_GNO_9400063
Sequence length 526
Sequence
MKSICLVLLLVAGFSHAQEAAQTPEQLCEDRPPEEYFRLSTEGDCRDVVRCDRAGIAGAI
RLAAVRCPAGLGFDVERQTCDWKAKVTNCDKLDRPRKALPKLKTDEPICPDGKLSCGNGE
CIDKALFCDDKPDCKDGSDENACSVDSDPNRAPECDPTQCSLPDCYCSADGTRIPGELEA
INVPQMITLTFNGAMNTDNIDLYEEIFSGLRLNPNGCQAKGTFFVSHKYTNYSAVQDFHR
RGHEISSFSVTSKDSSKYWTDGTYDDWLAEMAGNRLIIERFANITDGSIIGVRAPYLRVG
GNKQFDMMADQFFVYDSSITAPLGRVPIWPYTLYFRMPHKCIGNAQNCPSRSHPIWEMVI
NELDRRDDPTFDESLPGCHMVDSCTNIATGEQFGRMLRHNVDRHLSTNRAPLGLHFGASW
LKSKKEFKNELIKFMDEMIARNDVYFVTMLQVIQWMQNPTELSALRDFQEWKEKCDVKGQ
PFCSLPNACPLTTRELPGEILRLHTCMECPNNYPWILDPTGDGFSN
Download sequence
Identical sequences E9HBN5
jgi|Dappu1|327753|NCBI_GNO_9400063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]