SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|327801|NCBI_GNO_9500037 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|327801|NCBI_GNO_9500037
Domain Number 1 Region: 725-981
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-55
Family YWTD domain 0.00000327
Further Details:      
 
Domain Number 2 Region: 1340-1596
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-52
Family YWTD domain 0.00000697
Further Details:      
 
Domain Number 3 Region: 421-675
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-48
Family YWTD domain 0.000000969
Further Details:      
 
Domain Number 4 Region: 1032-1284
Classification Level Classification E-value
Superfamily YWTD domain 1.26e-47
Family YWTD domain 0.00000876
Further Details:      
 
Domain Number 5 Region: 326-412,676-719
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.32e-20
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 6 Region: 111-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000838
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 7 Region: 71-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 8 Region: 250-293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 204-240
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 163-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 291-332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000011
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 12 Region: 1293-1337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000186
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 13 Region: 31-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 14 Region: 986-1027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000008
Family EGF-type module 0.0067
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|327801|NCBI_GNO_9500037
Domain Number - Region: 1599-1627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00439
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|327801|NCBI_GNO_9500037
Sequence length 1830
Sequence
MITNQGSQRLGDCDRGQDESECGETVCHGIRCRSGSAGHPTPRCIQPDWLCDGDDDCGDN
SDEIHCEASRNCTASSFRCPNNGNCIPQVWVCDGDPDCDGGADERDCSVLLTRTCPPSQH
RCGNGACLPAEWRCDGDPDCSDMSDETGCQQSGDGGADGAVDRDCGADEFQCASGHCIKG
AYRCDGEIHCRDVSDELDCGSLLPRCVEGDFRCPDGQCIAQAWRCDGEQDCEPGVDEENC
DSSTVAGGATHTCGPNQMACSSSTGKNGPCISTSWVCDGETDCPDGQDEQNCPANHCGKD
QFSCSNDTCVGFSRVCNGERDCPGGEDEFDCTIQKECDAGSRCQHTCLVLSNGTGACGCR
SGFRLTSDGVNCVDVDECATETYCSQLCTNTVGGFSCSCVDGYVLRPDKSSCKALGQPVR
LIFANRVDIRQVSLFEEEYTSVIDGLQNAIALDFHYRKGLVIWSDVTLDAIKRAHLNGTA
MPDAVWWGLKSPGGVAVDWIHDNLYWTDSGVRRIEVSLLDGTMRRTLVWENVEKPRAIAV
HPGAAAVIWTDWGHQPRIERSDMDGSNRQILVTENLVWPNGLTIDYTVDHIYWADAKHHV
IESVRLDGTGRRRVMERGLPHPFAITIFEDSLFWTDWHTKSIHQANKLTGHDIRTVRTNL
HFPMDIHSIHPLRQPEYVNRCGSNRGGCSHLCLPNRSSYTCACPPGLQLITPNGRTCTSQ
PGELLIFAQKSELRLFPLNVSGEVDHVLPLTGVRSAVALDWDGASQTIFWTDVESDVINR
AFWNGSNQQTLVANDLESPAGLAVDWVTKKLYWTDAGTNRIEVSNLDGTLRSLLIWDGLD
RPRDIVVDPIGGYMYWTDWGQTPKIERAGMDGSQRSVIVISNLTWPNGLAIDHEGERLYW
ADGGTKAIEYASLDGKNRTVLIGAELPHPFGLALYENQIFWSDWDTAAIHSTDKLNAKRR
TMIRSGLDDLMDVRVYHSNRYSVPSLCQSHNGGCSHLCLLAPLPAGHSCACPTGIKLSAD
RRTCRQSPSTSLIFSQRSNLRRMSLDMPYLIDVVLDLPPQKNVVALDVDRVTGHLLWSDT
TQDKIFRALPGGPLSASAVEVIAFNLDTVEGLAVDEINRKLYWTDAGRSSLEVAELEDGG
HRKVLIWTLMDKPRGLVLSHSTGTLFWADWGKQPRIEQADMDGRNRKVMVSTDLGWPNSL
TIDYAANMLYWTDARKKTIESCDLSGLHRREVLTGLSHPYGITVLDSYLYWTDWETKSLQ
RADKNTALDRSTIRVGLDNLMDIKEMDASSHRENPCGTNNGGCSHLCLRSPWGRGYSCSC
PTGILMSADGSTCQPSPNSFLLYATRNTLSSISLDTADQWDVALNVPGVHNAIGVDFHWG
RQRFYYTDVYLDVIRSVDARNVSNVETLVSSNLTTPDGLAVDWLADNLYWTDAGRNVLEA
SRLDGTNRKIIIGSGLDEPRAVAVFPQRGLLYWTDWGQSHKIERSFLDGSHRVAIVTSEL
GWPNGLAIDYEGQRLYWADAQLDRIETSDLSGRFRVQLVQGATHPFGLTQLGGFLYWTDW
RSKSIERVDKATGKQRSVLRHGLEGLMEIRAVAREKQLGKNPCSTANGGCTHLCLFRAIS
YVCACPDIPDDIPCTSSVVNISASDDYWSPALDPFENDLEPTSDVYPHNPYRLDPSAGAG
VLHPSMIVLLVVGMAALLAAMAVLLIKWQRRRYRDCPWNSSRGPRQPQQVSVLTFTNPNY
SPSAPDVVVAEKKGFSWQRWKYDRTQERVYDMQDEKQSQTEAASLIPHSQPPPEVETDLE
AETDVIESSSGPSSTPPPTPPQRMDSICLQ
Download sequence
Identical sequences E9HBU7
jgi|Dappu1|327801|NCBI_GNO_9500037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]