SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|328421|NCBI_GNO_10200053 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|328421|NCBI_GNO_10200053
Domain Number 1 Region: 382-543
Classification Level Classification E-value
Superfamily C-type lectin-like 1.07e-29
Family C-type lectin domain 0.00083
Further Details:      
 
Domain Number 2 Region: 568-681
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-20
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 691-765
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000049
Family C-type lectin domain 0.0053
Further Details:      
 
Domain Number 4 Region: 783-861
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000406
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|328421|NCBI_GNO_10200053
Sequence length 864
Sequence
MINHTIIPGCYLKLHSTRGVVSSSHLPPQFERITSSQEHLMSPPLGCSLLLKIPSGSSFE
FTLRKLKLLRPHSRECHEDSQLQLATSTTWDPHKMMTDTKHFNSLHSSTWPNLAENHHWQ
VVRTFCGKIQDYSKSLRTWHTFEPWVLIRYRSSQRAHHHIHSSNGISNSFVLFKFNILGP
CLNVLLTERSKTIEFSESDLSASVPECTFRVHVPYGYRIHLSAHLTSDNAIVPYENEAVD
QPAVGRADESDENSLLTTNGDCQMTVQAEDITGHQTKCLNHRNPTASFSSLANFLKFQAK
MLQVTSQGRPTQICEKSSVKNFRCMLKDKLRGIFRIFISGMLEIKTGEEELKQFSNNSYG
KAAVIPGSSVVRLSVRYFSEADPRLTNGCGEGVLADETTCIWLHPEPLTWHEAEAKCSQM
APNGHLVAITSPEIQKVVDAVITKSADYEPEKSYWIGGSDQKQETIFEWSSGATFSYSKW
FSGWPVYQLYNAQPSDDGISNQDCVEIRQSFGQPSQSEALASGFYWNDRDCYVANPFVCQ
KSRNDVGIGDFKETMNCNRTEELNRLRTSTVVQSPFFPRPYPNGITCITDLSAPLGFKIL
LNFEFFDLEEEEDCNYDVLDLQNLDEILIFDERRDSSATPWRRCGNWNSRLKLLQWRSNE
NQARIMFNSDSSYNTNGFQLKASIERADLNCPEAGSIFHHGRCYLIAPYPEIGWFEADRM
CKSMQAELVLSDSNSEEIHFLIDQINSNEQLNNTAFYWIGQTNRFQLSIPQSGNRGIARN
SSIESHEGEVKSPNFPAPYGEDNHFRLHIKAPNSSSNSERLVVRFKQIDIEFQENCLYDY
IGLQSRENGPMQKICGHHTTNLER
Download sequence
Identical sequences E9HDM3
jgi|Dappu1|328421|NCBI_GNO_10200053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]