SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|328870|NCBI_GNO_11000035 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|328870|NCBI_GNO_11000035
Domain Number 1 Region: 3-45
Classification Level Classification E-value
Superfamily HMG-box 0.00000314
Family HMG-box 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|328870|NCBI_GNO_11000035
Sequence length 108
Sequence
MDKYSSKHPKLTKQELTRLMAKEFAKLSEEKKKVYGNMAQKSKNEMSATNKVASKTRKSP
TLAANQSLFKAEKMIHIYEPLKPPASAAEILTLAEIDVLKHQSVDNGH
Download sequence
Identical sequences E9HF02
jgi|Dappu1|328870|NCBI_GNO_11000035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]