SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|329129|NCBI_GNO_11500021 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|329129|NCBI_GNO_11500021
Domain Number 1 Region: 2179-2303
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-32
Family Cadherin 0.00032
Further Details:      
 
Domain Number 2 Region: 1864-1985
Classification Level Classification E-value
Superfamily Cadherin-like 8.9e-32
Family Cadherin 0.0014
Further Details:      
 
Domain Number 3 Region: 2702-2828
Classification Level Classification E-value
Superfamily Cadherin-like 4.19e-30
Family Cadherin 0.00096
Further Details:      
 
Domain Number 4 Region: 1970-2092
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-30
Family Cadherin 0.00099
Further Details:      
 
Domain Number 5 Region: 576-706
Classification Level Classification E-value
Superfamily Cadherin-like 8.9e-30
Family Cadherin 0.00091
Further Details:      
 
Domain Number 6 Region: 4024-4237
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-30
Family Laminin G-like module 0.0078
Further Details:      
 
Domain Number 7 Region: 3139-3260
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-29
Family Cadherin 0.0017
Further Details:      
 
Domain Number 8 Region: 1225-1329
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-29
Family Cadherin 0.00043
Further Details:      
 
Domain Number 9 Region: 471-592
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-28
Family Cadherin 0.0018
Further Details:      
 
Domain Number 10 Region: 2290-2401
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 11 Region: 1430-1564
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-27
Family Cadherin 0.0021
Further Details:      
 
Domain Number 12 Region: 1008-1121
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-27
Family Cadherin 0.0021
Further Details:      
 
Domain Number 13 Region: 3247-3349
Classification Level Classification E-value
Superfamily Cadherin-like 7.98e-26
Family Cadherin 0.00086
Further Details:      
 
Domain Number 14 Region: 247-377
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-26
Family Cadherin 0.0029
Further Details:      
 
Domain Number 15 Region: 2389-2489
Classification Level Classification E-value
Superfamily Cadherin-like 1.02e-25
Family Cadherin 0.00091
Further Details:      
 
Domain Number 16 Region: 3564-3669
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-25
Family Cadherin 0.00045
Further Details:      
 
Domain Number 17 Region: 1331-1434
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-25
Family Cadherin 0.0025
Further Details:      
 
Domain Number 18 Region: 3460-3571
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-25
Family Cadherin 0.0033
Further Details:      
 
Domain Number 19 Region: 900-1011
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-24
Family Cadherin 0.0025
Further Details:      
 
Domain Number 20 Region: 2820-2926
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-23
Family Cadherin 0.0018
Further Details:      
 
Domain Number 21 Region: 4263-4303,4347-4490
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-22
Family Laminin G-like module 0.0066
Further Details:      
 
Domain Number 22 Region: 2081-2183
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 23 Region: 1117-1232
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-22
Family Cadherin 0.0033
Further Details:      
 
Domain Number 24 Region: 2914-3047
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 25 Region: 3352-3457
Classification Level Classification E-value
Superfamily Cadherin-like 4e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 26 Region: 2494-2609
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 27 Region: 139-259
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-20
Family Cadherin 0.0045
Further Details:      
 
Domain Number 28 Region: 1771-1868
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 29 Region: 686-819
Classification Level Classification E-value
Superfamily Cadherin-like 6e-19
Family Cadherin 0.002
Further Details:      
 
Domain Number 30 Region: 2620-2733
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-18
Family Cadherin 0.0037
Further Details:      
 
Domain Number 31 Region: 376-476
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-17
Family Cadherin 0.0037
Further Details:      
 
Domain Number 32 Region: 807-912
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-17
Family Cadherin 0.0024
Further Details:      
 
Domain Number 33 Region: 1550-1659
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000542
Family Cadherin 0.0011
Further Details:      
 
Domain Number 34 Region: 1666-1769
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000542
Family Cadherin 0.0019
Further Details:      
 
Domain Number 35 Region: 3025-3156
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000011
Family Cadherin 0.0038
Further Details:      
 
Domain Number 36 Region: 3924-3965
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000156
Family EGF-type module 0.011
Further Details:      
 
Domain Number 37 Region: 80-145
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000143
Family Cadherin 0.0092
Further Details:      
 
Domain Number 38 Region: 3970-4007
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000887
Family EGF-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|329129|NCBI_GNO_11500021
Domain Number - Region: 3867-3931
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000661
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 3671-3765
Classification Level Classification E-value
Superfamily Cadherin-like 0.00926
Family Cadherin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|329129|NCBI_GNO_11500021
Sequence length 5030
Sequence
MALWYCTIVLFLQALLVHGQGPGPGPGRKSMDRLGNNQTTNIMPDQLMQSRAVDMRIQLE
VAEEKPAGTVVGLIPTKPGFTYRFNENPREFRLNGTTGEIVTAVVLDREALSSDRFDLVI
LSSQPTYPIEVRILVVDINDNAPAFPEPTIEVSFSESANTGTRVILDTATDGDAGENDVT
TNYEIVGGNDDLKFKLAVTTNPSGETPYLHLETTGKLDRETQNHYWLNISAQDGGRPALL
GYLIVNITIVDVNDNPPIFDHSDYVVSLNESVPPGTHVMQVTATDNDAGENARVTYYISE
SETQFAVDAETGVITTTEQLNCQRSCPQLVSSCNKSCVFTVFARDHGNPRQDGRTYVTVN
LLDANDHDPIIRFRYFPATADFATVDENAQNGSVVAAVSVIDFDEGANGETTVEIKAGNE
LVHFRLEETPSFHIVRVNGVLDREKISKYNLTIVATDSGSPARKALAFLIIHVNDVNDHE
PIFEKSEYSAVLSELVSVGSYVAGITATDEDTGINSNIFYAIVSGNDQQWFDIDMVSGLI
TTHHQLDREQQDTVELRISARDGGPNPRWAYTHIKITILDENDEHPQFVQQSLKQVNLSE
NTPPNTLVALLTAVDHDQGTNGSVSYMFDSQMDQRYPGIFAIDASTGRVTTRTKLDREVI
PEYEIKVVARDQGNPPLSSTATIVLRVLDANDNSPEFYPQQYLVAVSETLQVVKIYKEPE
VVATVTAMDEDEDENAQVTYSIKSGGEGVFDVEEQTGIIRLRSPLNSARKAQYKLKVAAK
DRGDRKAVEDAVVEILVENSPANYLDFGSSSYHFVVVEDPGKKEPAIGREVGRLSVNNKQ
VQSSPKYSIIGGDQFKVFQIDEITGVLTTAKRIDREKQSHYQLLIVARSGFSYGTVSVNV
TVQDVNDNPPRFDKTRAVARVVENWPANHEIYLAKAEDLDTGNNSRITYSLTLNPHELFT
ISPTLGMIYLNRPLQHEQFYFESSLTLEVTATDDGSPPLSSRQLVTLNLEDVNDHTPVFE
YSSYETSLLETISVNERFFALSAMDRDKGANGRVSYFISEGNEAVKFGIFPDGMLYVKSP
LDREAKDYYALTVVAEDGGMPPRSSSVSVTIHIIDENDNPPKFNNETFSFYIPENEAPDS
YVGRLTATDRDVGRNAELTFSIATSQSDFSIDPKSGFIKTLRYFDRERLLQTTGQDYIVL
EAVVSDNGVIRLRDRARIHVFILDVNDNAPAFSRVPYKTQVSEGAAVDTQVFRVVATDAD
DQLNGGIFYYITEGNGDHKFRIDEASGQIVLNRALDRETSDRYTLTIGARDAGLPNLSTS
TTVIIDVLDENDNAPEFMHSEAKISALETLPVGSELVTFQATDADLGINSEIAFSIGAGN
MHDTFRIDPQLGTLYLEKHLDFEMQRSYHLNITASDQGNPSLVSSISFVITVEDANDNAP
VFPSTAIVRQIQEGIPLNTPIVTVTAEDPDSGLNSRIRYSLIQQEPSVLVGSSTRGGSGP
HFAIRPDTGVVYVVRPIDREFADTFRLTVVATDQAEPASNRISAEKLVTVIVEDINDNAP
TFTSVSAGLLPKGAERGHEILHIHAADADANTNGIVTYEMVSGDAELFSLERSSGRLTLR
KDVATPEITYQLSVRATDEAVHSQRKSTGLHITVISVTEETTGPLFSKKLYTGSVSENEP
AGTNVLTVSARYTGNPLAQVEYFIYNVTANNRGVPLVFEIDPESGVVSTSGILDREANAE
EYELDIIAVTRATPSPQTSLCKARVKIVDKNDSPPVFRDDNAVISVSEDLIIGQPITTVT
ATDLDKTGTVVYTLVSGDDGKFTLESAKGILTLRDNLDREFQSQYKLTIKADDGEQFTET
VLIIKVIDTNDNSPTFSEAAYSFDIPEDTGRGAFVGAVVANDMDEGINAQVSYTVLSDWG
NDVFSLNPQSGVFTLTSRLDYEQVQHYIFVVQAQDTGRPSLSSTVTVYFNVLDLNDNAPL
FDPMSYSDELYENITIGSSVITVSATDQDSGDNGKLVYSIIGGNENEQFRITQNGTIMTS
QSLDRETQSLYNLVIMATDQAKPPEKRLSSTVQVTIILKDVNDMAPEFVSSNETAVMENI
PINTVVMAIKAIDRDEGRNSYIEYSLAPIDDGCFTLGPVDGLLRVSALLDRESRANYTLH
VMAYDRGLPSRSQSLDVLVRVLDENDNSPLFDPKVYSASVSENATIGLSVLQVSATDLDE
GLNGRVRYTIVGGDINFDFHIGEDSGIIRVAKNLNFERRSQYVLTIQVEDSGNDVRYDTA
TATITIMDINDNAPIFLDSPYIAYVMEENNRLPVPIITVQAHDADSPPYNRVRYLIKDGD
KGLFRVNGTTGEISVLRSLDRETQSRYEIIVVAMDSGVPVLTGTGTVLIFVEDINDHSPE
FSQSQYRSDVVENGPIGLSVTKVSAFDNDSGENALIRYQLKNDKDKFRIDSSTGEIFTQT
KLDREERSKYELVVVASDSSLTNTRTTEVNVILFVNDVNDHPPIFREMVDIIYIPDNIQP
GQFVLGANAVDADVGLNGKIVYHLFGDDASKFSVNQDTGVIKASTLLASSASKSATFKLE
IRASDSGVNSLSSISTVEIQLRPADQFPVIRSDAKSFTFSEQIENRVFTTVIATSPKTGA
AGEIQYGIAGGNTGDVFQINSKTGEVSIGTGLDYEISTQYELWIEARDSDDISLASVTRL
LINVTDFNDNSPIFHHAIYYASILEEQFPPSPLMSSQLVLTVHATDLDSGRNGLVRYQLR
NSGDLDNAFSVDAESGKIYTNVKLDREDVGHYVLIVEAVDQGAPQRSGTATVSVTVADKN
DNPPRFTRLFSVNVTENAAIGTFVIQVTSSDRDIGVNANATYSFTENPTGKFRIDPVSGN
VTVAGVIDRESKEEYLLKVSAVDGSWRAETPLTITVQDQNDNAPEFEHSFYSFNFAELQR
NVAFVGQVTAADRDKQGPNAMITYSIKHPSEFFSIDLTSGEILSKQTVRYKHTNKGSSPE
NMYTLWIVATDNGKPPLSSECLVSVNVINANSYAPRFDKSVFFSPVPDSAVLGQNILQLM
AERGQPDTIGGGTVQADSVEFTKVGGNGSDFFNVEKETGWVTVTGPLFGRRDMEFVLVVR
AYSTGAPSTHDETLVRLVVTGENRHTPIFTALSYQIIVQENEPLGSIIVSVTASDNDSGP
NGVVHYAIVSGNEENKFLIDPNTGDISVANTLDFDTLPKFTLNITATDMGFEPKLATATL
TVLLTDVNDNPPRFNQSHYDGFVRENLPPDTLVMDLEAFDADSAKNGIIQYSIIGGNGKD
FFTIDSETGVVTTKSSFDFEEKNYYELDVLASNPDSSMFGSTVVRVHITGRNEFFPKFVQ
PVFQFTVSESVPVGASVGIIQATDRDNGEDGEVFYLFVGSSNDRGFHITPETGVITVARP
LDRESHARIVLSVMAKNRGGIRGNDTDEAQVIISIQDGNDAPVFVQPIYHVLQLVESAPI
GTKVVTVEAVDKDVRPPNNEFTYSILGGEGSKAFRIDPRSGIIETVSLLDRERQAVYNVT
VGAIDRGVPPQTGTTEVHIVIQDINDNGPVFEPVHPVGSVFENEPPGTSVMILSAIDADQ
APNAEPFTYTIVGGDHKDYFVVDKDTGVLRTTNILDREEAPQMTILVEIADAGTPRLKSQ
LPVSINVLDRNDNPSTARTVRLVVNIYTETFIGGRIADVRPNDLDIAGQYQCRIVSGQSV
SAANLFSIPRGCNLHASRIHKPSDYNLKISGNDGVHPDVTSSISISFTSFDNKTLQNSVT
LRLLNTSTERLLVNHWKPLLDALQASVSFGTVHIYSIHPEGDHVDLTLAVQKPQGDYWDQ
ESVATFLDTAKDLIQKALTPSTRFVSNFTPCQNMPCENGGVCSSTLRMSEELETVDSPVF
IFTSPRLENQFICSCKNGFSGSRCELRQDPCTPSPCRNGGACTRQGSDFQCSCPLGFQGK
QCDQERSRACEHTPSPCRNGGSCQETQEGAYFCLCRPGYRGNQCELTSDSCRPNPCLNGG
ICENRKPGYRCLCSDNYFGTHCERSSFGFSELSYMMFPPLEASTNDISIVFSTNMDDALL
AYNFGQQTGGRSDFVALEIHQKKARFMFGGSQTAIASISVPKIVSDGKWYRVTATRNGRI
GSLSVGECSHTGESCRDCRSGDRTCSADYTGPTGTLNFSNQPMYLGGVATIESIQDRPGQ
VHSDDFIGCFQSVSVNGRSLNLSNPLKSRGVTSTCQRRRELCNGHGPSCGVGGTCVDGWS
NATCVCQGGLQAPNCFAALEPMSFTQGSYAEFYISERHRRRQIIRALYSSGQKWKREIAE
EFRSISGRFSQSRIPREIGESISLHNSVSVSFRTVAKNGYLFFAATNNDFTALKLQDGFL
QYASRYGSGSLVNMTVEDTMLADGTWHNVTLTSKFRTLRLILDGVEVGDELDMSIVHDFM
DPYLTSVIIGASEFEGCLANFTVNDEIQPLNGSGGIFDRVVHHGRVLTGCSNSIAGASTA
PDPLSIGITLVIVFFVILLVAILISFVVVRVRRQQRDKKAGLQINKHNGGAMMGGGSIND
PSRTLAESGYVETSDVSEDGCVRPRLTQDMASKKFREREVADHRDRDRPQRPDIIEREVV
NKSPGVPLRVEDSHLGDNSSMTGLGLGDCEGPEHYDLENASSIAPSDIDIVYHYKGYRDG
NVRKYKTNPHVPSYHKHSHRHSPHSFVSPTHRESPRNILRSSPAPGLPGGPPVAPPRESP
GVLKMQSTPLARLSPSSELSQQTPRILTLQDLSGKPLQTALLATSQVGGVKDVMSTSERS
LNSPVSQLSQSTSSIRNSSQATKKKKKTGSEMGVALGLTAEEIERLNSRPRNSSLVSTLD
AVSSSSDDRPRSKEKLSELMETNTELLETAESSTDESGNDSFTCSEFEYENNYEKVSRDF
GPGNMIFSKLAEVDNENEHDNESGKHYDGFDSFRGSLSTLVASDDDLSNISAYKPPNGSS
LGWDYLLNWGPNFESLVGVFKDIAELPDCNGRNNVSSRMVVCPKANEEYI
Download sequence
Identical sequences E9HFS0
jgi|Dappu1|329129|NCBI_GNO_11500021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]