SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|329313|NCBI_GNO_11800005 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|329313|NCBI_GNO_11800005
Domain Number 1 Region: 52-103
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000294
Family Hairpin loop containing domain 0.078
Further Details:      
 
Domain Number 2 Region: 327-371
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000196
Family Hairpin loop containing domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|329313|NCBI_GNO_11800005
Sequence length 374
Sequence
MTLECRLSSSDKRLRPEAFVDAPSQVEYLENQCVSLDDFDEGLTVVDMYPRYLDSLVANI
SDDKHCQHQCSNNRAFACRAYSFYASVSQCFISSDDRISDGPSALLSRPGTNYTERSCGK
RAAIDEINKRNDSSASFFAGKGGFGGLSDIGVMPDFMPADTPVNTGIVRFPSAAALAAAA
DVNSGNNRFPSFGSFGGDSIDRLPVSKCRSDRPHYQKVTGYEALTSRFMSLRPATPATIE
RTGVLIDCLDKCNIDELCSGKDNNSIKQTCVGIESADGSDSSDAFVQLPLPRSNGSDNFL
LRPNSGFSYFESLCLQAVGCDSVWSTERTPGYFMRGVEQEIIRGISRLRCTERCLDERRF
VCRSASYDTNPYQS
Download sequence
Identical sequences E9HG92
jgi|Dappu1|329313|NCBI_GNO_11800005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]