SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|329385|NCBI_GNO_11900003 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|329385|NCBI_GNO_11900003
Domain Number 1 Region: 165-249
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000000000000192
Family Hairpin loop containing domain 0.057
Further Details:      
 
Domain Number 2 Region: 841-915
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000000000314
Family Hairpin loop containing domain 0.046
Further Details:      
 
Domain Number 3 Region: 1239-1318
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000000102
Family Pan module (APPLE domain) 0.04
Further Details:      
 
Domain Number 4 Region: 456-539
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000000314
Family Pan module (APPLE domain) 0.022
Further Details:      
 
Domain Number 5 Region: 102-155
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000104
Family Pan module (APPLE domain) 0.06
Further Details:      
 
Domain Number 6 Region: 544-610
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000726
Family Hairpin loop containing domain 0.07
Further Details:      
 
Domain Number 7 Region: 272-315
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000314
Family Pan module (APPLE domain) 0.041
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|329385|NCBI_GNO_11900003
Domain Number - Region: 1343-1401
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000942
Family Pan module (APPLE domain) 0.047
Further Details:      
 
Domain Number - Region: 744-787
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0135
Family Hairpin loop containing domain 0.046
Further Details:      
 
Domain Number - Region: 396-448
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0188
Family Anti-platelet protein 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|329385|NCBI_GNO_11900003
Sequence length 1949
Sequence
MDYYLNHWIRMFTVKRRRKVSDTADNRLSDMLMVLCLSQKFFSQRRIMSILPILFFTLGV
LVTETRAQCFGGVETYEKTAGVAFTSVSNLQGLVSQPGTAVTRDCAALCKQTATCAAFTV
DYSTSRCQSIDIDDVKRKDHLKDVAGVNYFEKICLRLNNFNSICGDRLWAFERVIGASLQ
GFDDMEQKSVQSRSDCQRLCLEQTNFVCRSAEYDESEQTCRMSREDRRTQSQAFRRDAGS
WDYLENQCVKTLPDCRYAGRPDGSLTVSMDQVEFAQSQGECESLCDQARVFTCRAYSFTA
DENRCYLSGDDSISQSSPTVSQLDGKILTPSGSSKKSTVYAEKLCSISQCENGIFTFEKV
TGHFLRSARQDMINRGKFLDTSSRTGDPAGGGITVECGRACLEMGGDCPAYSVDYAQGRC
FKLDRNSQGRAQELTIREGMSYFEKICLRGNVGPCRDRAWAFERYPGKELRGMEERVIPL
VATRRDCEELCLRESRSVCRSARYDTMTLECRLSSSDKRLRPEAFVDAPSQVEYLENQCV
SLGNTMCSYQTVVDMYPRYLDSLVANISDDQQCQHQCSNNRAFACRAYSFYASGSQCFIS
SDDRISGGPSALLSRPGTNYTERSCSKRSTIDEINKRNDSSASFFAGEGGFGGLSNMGVM
PDFMPADTPVNTGIVRFPSAAAADVNSGNNRFPSFGSFGGDSIDRLPAKNNPPIRIPPIS
KCRSGRPHYQKVTGYEAVTSRFMSLRPATPAVIERTGVLIDCLDKCNIDELCSGINYNSI
KQTCVGIEYADGSDSSDSFVQLPLPRSNGSDNFLLRPNSGFGYFESLCLQAVGCDSVWST
ERTPGYFMRGVEQEIIRGISRLRCTERCLDERRFVCRSASYDTNRKECYLSPDDRYTKPR
AFQSNPIYDYIENQCSPSDSRQCRYAPLQPDRYLLYADRMVSGTSQTAASCQTACDSERH
FRCRSFSVYVVLGLMQCSMSSSASPAYEVQRGSQSSEKECSTVINNEIPVQLETAHLGLG
GNNRGNRILPGTTGVIPPGGDPGGWVSLAALSRTQVGNRINNAYNGGSGITPQHFNPVLR
LPPIGVRRPVDSSVYDSGFQYNTVSVPNRPFLSTDSNPTSNSFDGNIARCKGSVTYDKIV
NVDFVGVRRQEIRSSGDGSPTLECLRECDRLRERCLSVVVMADRFSPDLSRNGTSGTPRM
RCYILDRSASADSAALSFTPNSVYYEKTCLPDTGCGKAWSFVRVHGYELDGFDNHVARSI
VSKEECQAACMRMPNSQCRSAEYLPREKLCRMSSENRRTQMRSFRATAPDVIYMENQCAG
DPPHCEYSDQTGRMLPWYDRVIAIENQQSPTLALAECRRMCDAERDFHCKSVSVSEQRRS
PVCLLSADDSVSFSGVNVANVLIPDRDFTYSERSSCNNMRVECTKTDMLVTLAFGYPFNG
RVYVNGNYQSCFEMGNGQQQMVLRVPLAGQCGTVQQSRGRYVNHIVVQHSPLIMQDTDSS
VRVECAFEASEQTITYSSTGNRRDGSDNVGPAGLGSIDVTSPLRQLGHSVVTNTAPTPSL
RMRILTRNGQESRVVGLGELLTLRIEIDPSSPFGITARNVEARTDNGEVMTLIDATGCPK
DGNVFPPLELDLTTKSLFAEFKAFRFPSTATVNFVATVGFCQERCEPVRCTDGFESYGRR
RREANATTSTSEPEMTTPSQLEVTSQQVTDISSPFETLMTEKVERNTTSETPAGSTEGPA
PTTNAAEVTLIPPEENEIPSSTTQEMTTEPMNKPTKTGQNVPVEVPLQLQLIVAPEADRI
AILPSALASTNREGYDYDASNRRRPSWRSPSFNQDPSNDDDSLDCSSKSTLVAVSVVAVI
LQAATLVAFYVFYRTKQSSWTKCSDSRKITNTEPVYGIRHSGSVSDVTFRSVYGQKSGPG
TLTRAFNLDVNSSPRGPHVASVFTTPDPL
Download sequence
Identical sequences E9HGF3
jgi|Dappu1|329385|NCBI_GNO_11900003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]