SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|330316|NCBI_GNO_13800025 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|330316|NCBI_GNO_13800025
Domain Number - Region: 403-430
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000612
Family Ovomucoid domain III-like 0.019
Further Details:      
 
Domain Number - Region: 364-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family Cripto EGF-like domain-like 0.02
Further Details:      
 
Domain Number - Region: 461-576
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0488
Family Cell cycle arrest protein BUB3 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|330316|NCBI_GNO_13800025
Sequence length 596
Sequence
MVKDCGELLLTEPLWKCFMSKSPPSSPERSAHNNDRAINDIRNSKPRSLIDPSKTVSTTI
TTTTAIQRSSYDAAKLSCCDRGTLQCYRLCRMAHTNEFFPETEELDNCVAQPSEAAVATC
FEDVDEPCQPGCSNLSFCSSFNNRPLELFRNCNPEADAAAQNVFQEWIRMTRVVLPGLTG
RQDVKLWGPSTCMMPQWKALACALQFKPCRRNMLRTAICWNSCIKLLSGCMTQYNATLAV
ELCNRLTPESFTGACISLEDYVAPQPKTVAVVAPCRYNTCRTDQVCVVDHRSSNGYSCLP
GCQFGDRSKLLGFPKSWVQLPTPSTSCYYNSCNEVCYCNGKGELQQCHTPPLQPFEACRV
GQQQFEHGTRLQNDCNQCVCHYGELICTRYRCDNSSGTSAVIWSCPLQPNPVCTSSGKRF
LNTCVAQWHGTAVEPLEHCPQEGPDGFFAPECYTVIQLVYSQKQIDRLSRSTNKSTIFSA
SLVEQSLRYLLAYSHCHVSVFHSFDGELLAVIHSQMHCASCSAEAEKLVMLFDTRSPQVT
LNVQLDVILLAEVVQFVQLHPSHTHTLSSGGRGGVFANHVQSIYIIPFFLSLLRFI
Download sequence
Identical sequences E9HJ79
jgi|Dappu1|330316|NCBI_GNO_13800025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]