SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|330318|NCBI_GNO_13800027 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|330318|NCBI_GNO_13800027
Domain Number 1 Region: 95-291
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.67e-37
Family Astacin 0.00044
Further Details:      
 
Domain Number 2 Region: 308-371
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000732
Family Tachycitin 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|330318|NCBI_GNO_13800027
Sequence length 383
Sequence
MSHSNLVEAIAIAMKFTNAMPLWLAVAILAIYSPTESKSFPKATLAKPPINDVKLSSSSR
GMPAYVDDDIFVSLKSRTESFSESLNPSWVNYSDPKLLWNPQDIPYFIDPSLANYTHVIT
TSISKFSEVSCLRFRELYSHESNLWPKDYLYFNNSEGCASFIGRQGGAQLISLQAERCTA
DGAGKVMHLILHSLGFGHEHNRPDRDKAIRIHWLNVNETKRHYLIKYNGTDAAMYNESYD
YDSLMHGSNTLFTINSSLVTLTARNDSIMELGNRDHLSEKDIRRLNARYSCSSTTEAPTG
QTGCDPTASAPTCYGETRPTLADPTDCTKYYVCQGSEPIRMPCPEGLFYNPFIFVCDWPW
ATICCPATKRPNSTTISHMANTE
Download sequence
Identical sequences E9HJ82
jgi|Dappu1|330318|NCBI_GNO_13800027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]