SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|330677|NCBI_GNO_14500074 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|330677|NCBI_GNO_14500074
Domain Number 1 Region: 38-120,154-180
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000186
Family C-type lectin domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|330677|NCBI_GNO_14500074
Sequence length 187
Sequence
MVRLRNLKDRMSQSTLFRIWEGTCPLEFDSQFECKIVTELRGCICWSSKKEKVNWFTADA
FCDYHGMHLISFPFGNLDEDQTVKTLMTAGIWTSANDFITRRVWIFRNGSILSREKAFKR
SLRSLQIIGLDELTLSGLPPLNENTTSSWTQPTTCISSSLNNNTLTFYPESCLEKKQFIC
QQFINIS
Download sequence
Identical sequences E9HKB5
jgi|Dappu1|330677|NCBI_GNO_14500074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]