SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|330728|NCBI_GNO_14600041 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|330728|NCBI_GNO_14600041
Domain Number 1 Region: 153-245
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000144
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number 2 Region: 119-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000131
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|330728|NCBI_GNO_14600041
Domain Number - Region: 278-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0103
Family Spermadhesin, CUB domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|330728|NCBI_GNO_14600041
Sequence length 335
Sequence
MRTAEIVIPPKLSGDSSTESLMDRPIVVNSNSLKLNWKDNSGCAPQMTSLNLKVLQDRNE
VNAFSMVLPTNPQTCSIEWKPRDKCRKYTFDMSSQYTATWNGSSTSLDIFTKGNKGTKER
QCISKEKVCDGNYDCVDGSDEHYDCEYAKSCSELKDTYGSFSSLTIDSDNVFKNAAQKTI
VAISVQSNQIIWLSFSMFNTKENHLVKVYDGPYSTSPLLLSQSGSTKPSSIRSSANNLYV
EFPSYYDKSYGVSVSHTSMDNMEKPFVPGCGGYVYGDGSVSSPNYLSNNNNDFDECFWFV
EARQSAAKRRSHICKEKYRPDRQISSFYGSLYASF
Download sequence
Identical sequences E9HKG2
jgi|Dappu1|330728|NCBI_GNO_14600041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]