SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|331011|NCBI_GNO_15500010 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|331011|NCBI_GNO_15500010
Domain Number 1 Region: 145-211
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000000053
Family Pan module (APPLE domain) 0.011
Further Details:      
 
Domain Number 2 Region: 218-280
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000000334
Family Pan module (APPLE domain) 0.071
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|331011|NCBI_GNO_15500010
Domain Number - Region: 62-119
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00824
Family Pan module (APPLE domain) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|331011|NCBI_GNO_15500010
Sequence length 683
Sequence
MEMSSRSLAVAVLLLLARLSAPVESQSAETTTGDCSGQDTTFELRTGYVFTAPEEILDTR
PDTLQLSDCIDNCRANSSCSALNFETGLCVLFRTNAFDTPEALTKSQFPVYTIYAQKICL
ANASELCVDRPWAYEMVPSFEMSAFVREKKTAATRRACMELCLNEKTFQCRSASYNAVSG
ECSLSDMDRFSVTARSAYSTTPDVDYFETNCADDPVKMCDFQRTEGRILKTVDAVYQDVE
DEEACKSLCLNSNFRCHSFDFGDTGEKVCRLSHHSASSLSQIQDPYLEIPEAKTYELTSC
YNVTIDCRSTDMIVRVKTNRIFSGKLYAKERPNSCVTDVARGLEFELKLGYQDLGCDVKQ
EGPGKFFTEVVIQHHDQIVTSQDVGLALRCSYQLQNYTLTSGLDLSVASRVPTIAEESTV
VPGPTVLMKIAARQGGDVQTAQVGDPLSLFFEIQEPNTPYSIFVRELIATDGVDNSEILL
IDSRGCPTDQEIMGPINSMNGTSKTLRAPFDAFKFPNSDVVQFKALVTPCLPTCEPVQCD
VQDYLGYHRQIESLGKRRRRRSEANGQDPHNLLVVQSIRIADKFQAAADTSPAKTKTAST
ESEVAVLRNSDGLLNHHSDMPPCLNLLGLLMAGALFLVAQAVLIGAWAFIWQKRRQTKMA
ETTIESDRRFFSTTYANNAYATS
Download sequence
Identical sequences E9HL86
jgi|Dappu1|331011|NCBI_GNO_15500010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]