SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|331029|NCBI_GNO_15500028 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|331029|NCBI_GNO_15500028
Domain Number 1 Region: 26-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000068
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 2 Region: 171-209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 295-329
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 4 Region: 255-287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 5 Region: 211-250
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000524
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|331029|NCBI_GNO_15500028
Sequence length 380
Sequence
MVEQITFLPVLLSSSTVSCTALKTQHSCDKINLIESSAGQILSPSRDYGNGNISYPSRVN
CAWYIKIQPGSVITLSFSMFDLEEGRHLCSAKPCCGDTWLSILSIPSHSAQLVPMFNFPV
QDTVNFLYCGSLSLPPLVFSGSGLILTFKTGDMISGGKGFVLDFTIDKPMRNYCEDGHFH
CANGKCILKSWLCNGWDECGDSSDEQNCTVACKTGYSHCSSNSSLCYDFIHGRCNGILDC
PSGEDEQACALTCGNQLSCRTRGGCYRSTQRCDGMNDCPDGSDEDGCDAALCGPHRDGFL
CRNRHCVTASARCDGVKDCGDFSDEETCMKMSVITAVILGSLICGLLLVIAAGCGLRLYH
LRVALEQRWSTIRLQQRTVQ
Download sequence
Identical sequences E9HLA4
jgi|Dappu1|331029|NCBI_GNO_15500028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]