SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|332869|NCBI_GNO_21000021 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|332869|NCBI_GNO_21000021
Domain Number 1 Region: 50-153
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000251
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 1939-1985
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000004
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 191-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000544
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 1772-1824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000821
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 396-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000996
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 206-327
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000148
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 1004-1051
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000226
Family EGF-type module 0.02
Further Details:      
 
Domain Number 8 Region: 2303-2352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000185
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 3063-3098
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000684
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 10 Region: 446-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000199
Family EGF-type module 0.029
Further Details:      
 
Domain Number 11 Region: 484-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000201
Family EGF-type module 0.014
Further Details:      
 
Domain Number 12 Region: 527-643
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000204
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 13 Region: 711-755
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000239
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 2-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000544
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|332869|NCBI_GNO_21000021
Domain Number - Region: 327-447
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000251
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 3017-3148
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00534
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 1437-1491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00849
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 2964-2995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00925
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 2247-2419
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00989
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 970-1015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0107
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 1401-1454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0243
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 1192-1232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0336
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 781-820
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0378
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 1124-1156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0399
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 1907-1954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0431
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 2458-2493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0839
Family EGF-type module 0.075
Further Details:      
 
Domain Number - Region: 3157-3188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.086
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|332869|NCBI_GNO_21000021
Sequence length 3531
Sequence
MCGLGAQCVNSAGSYDCVCPSGYSGDPKSRCLDVDECSVSPSVCRTIPGAQCSNLPGSYQ
CFCPVGFQGDHNNNNINECLSKPCGANATCTDTVGSFSCSCVEDFTGDPYRGCVDIDECA
VLASPCGKQAICENAVPGYNCRCPQGYAGQPTPDVACEQVDVATVCKGNFDCVNNAECLD
GQCFCRNGFQPSGATCVDIDECAKNPCGPNSVCTNLPGSHRCECEAGFVGKPPTTPCKAP
CEDVKCGTHATCKTQGEEAFCVCDEGWTYDPANIAAGCQDIDECQRPGVCGTGAICVNVP
GSHECRCPEGTAPEPDAKTKCVSLMRCAIDDDCPGNSVCDPTKECLCPEPNIGKDCRHPC
EGVRCSANQECMLINDVAKCMCSSGFTGGVNGGCVDIDECSTGQKPCAQGAVCRNEPGRF
VCECPNGFEGEPYKTGCIEKATAPPGCSILPCPSGEVCVPSDNGGVCVCSRGWVRDKKTD
LCRDINECLESPADKPACGFRAVCKNLPGSYDCSCPKGYEGNPFQSCDLCDSIECRCQPP
YRVVGGACLLADCAGGKQTCPAGAECITVTGGVSYCACPTGYRARPDGSCEDVNECQEGI
NGQSACGFGAECFNRPGRFDCQCPANFTGDPYKGVCAPSQVRCVSDTECGTNERCVQPGE
CICPPPYYTDTEDNNKCKSPCERHACGVNSKCTPSDPPKCMCEPGHTGNPTVGCSDIDEC
RDNPCGPGAMCINENGGFKCRCPSGQSGDAYQDGCRGEARSECQADDDCDGQLACIQGGC
VNPCQALPCGANAYCEPEEHAAWCRCLPGFKEDAKTGACISLCHDILCGENAQCVVSSTG
PTGTSTTCACLDGYNGNPFPGGSCSPDVCSASLPCQEPQLCVSGRCKERCEGVTCGVGAR
CDKATNQCVCLPYFIGKADLLCVPPVIPPVCQPPCGQNSHCEYGQPNRCVCNAGTSGNPY
ESCGAQEKTCDATKCGINAECRQGVNRVDCVCPVGYQGNPYVSCEDVNECIGNACGANAV
CLNTPGSFDCQCQEGFSGNPFMMCMPIDQPPPVQPNVVDPCTSVTCGPNAACRNGQCLCL
PGYSSSAGGLCSVPSCRNDLDCASREVCLPVDHSVKNGGVRRCVDACSREQCGPNAVCVA
DTHRASCICRDGFKGNANVGCQQEPAEDKCGRDDECPGDTVCGKDVDGLRVCVDPCKSFT
CAQSESCVIKAGKAHCECLSNFVRNPSTGTCEKPGLPDCVTNTDCKSDSVCRQDILGVRK
CTAVCVGYTCSANSDCRAANHIGQCVCRAGFTGNPNDRNGCRPVPKDQCQTDTQCSEVEV
CQPDSNGVRRCVAICPTVRCGSGAVCVANNHAAKCACPTTGLYAGNPSGPEGCRKVECLA
NSDCPGTKSCDRTTYTCKPVCVQNSCGKNAICLAENHMAMCSCPVGLEPNPHPEIECVPA
DLCTSQPCHASAICSMSAGRVVCSCPLDKVGDAYRTGCRANGTCPNGNNDCPSEASCLDG
RCVDPCDSFCGPNAACRVINHKPSCSCPPRFNPNPTAERGCVRQPQSCRSDGDCPSGSPC
MGGQCKAVCRNAQDCAQGERCVSSMCQLPCLSQEQCPNGQACVGSYCKAGCRADSDCPIN
QACLNHRCENPCQREGVCGTNALCRVIDRSAQCACPDGFMGGPTAQQGCMRNPLYCQSGT
ACPAGHTCQSGRCYPTCRDGVANACVGGERCLSGQCVKICYSDNNCMPGEVCIDGGCRPG
CRSDTDCSNSQVCRNSQCRCAPGFTAGPTGNCVDVDECQTRPCHATAQCTNTAGSFRCSC
KPGTVGDGYTEACVAANECETSSGCADQLACLVRQGGTKACADPCAANTCGPNALCTVVD
HQPSCSCPPSTRGNPNDSKVGCFRVDCIENEDCPQDRTCDKQSFKCINPCDSMECYNGLC
QVKNRKTVCQCAPGFRPTQDNKCVDVDECSTNPCHPSAVCRNTPGNFQCVCPDGLVGEPY
KAGCKRPGQCVADSDCPLTASCVSGTCKDPCGLAGACGKGSDCVTENHLPVCRCPFQTTG
NPKIECYTLQCVDGSDCSQKEACVNNKCVDACAASNACGSNSDCTAVNHRAVCECKTGFT
GSPYQGCVALVLCASESQCPTSQTCTGGVCVSRCQSSRDCLPSQHCIEGKCRPACTENSQ
CASGQICYNSVCVQEVRCRSDQECGDGENCLKSTNGKAECRNPCDGTILCGRNAACRVVN
RQAVCSCKEGFFGNPQDDKIGCLKIECTNNEECSADKRCHDNRCKIACMVENLCGKNTLC
FSEKHQSVCKCQPGYTGNVQTGCTPIDYCSQTPCAAGARCENTRGSYKCLCPAGTVGEAY
KEGCQQPVECRQNTDCPPSAVCGREKGQPKCQDVCAGYSCGPNADCLPANHKAACVCRQG
FEGNAADRNVGCVRQPVSCKAQPDCPPNTFCYGGICKPACQSNVECQDGEACVRGQCVNP
CLLDGACGMNAQCRPVNHAAVCSCSAGFTGSPKTECIRVPVACRRDSECGSGNRCNEGRC
VPVCTSDSKCAINEKCVAGQCMLTCRVDNDCFLSHICLNNMCTIGCRQNTDCATDEACID
SRCKNPCSSEAVCGPNALCNVVNQRAQCTCPAGFLAYPTPNTACVREPTPCTGTKSCAAG
FTCQNSVCRPLCSADSQCLVNERCGQGMCVPVCRQDTDCSSGEICSMGSCKTGCRVDPDC
PMTHACLNAQCVSVCASPAACGTNAKCTGTNHRAQCTCLEGLVGNAKVACRYPPSTCTGT
TDCLANQKCIGGMCRPGCTNDQGCLSDSRCINGACSPVCNSDNFCDRGHVCLDRVCVVGC
RNDATCPASQACINNKCVDPCRVPNVCGNCAVCEVINHAAQCTCPSGSIGNPQVGCAITP
TRCSTNGDCGSGACISGLCSKTCTKINDCSCGESCVQGRCRLKCSADNQCPTGQLCRFGS
CAAGCKANTDCAVQQACINGQCKDPCQVSPCGKEAECRISDHRAVCLCPNGYSGNPTVGC
EKNECERDGDCDMEKRCQNNRCVLPCLEAGACGVNAVCRSVNHKAQCLCPPGYFGNAQID
CKQDVNECLSNPCGANAVCTDNVGSFTCTCSPGCIGDPVRGCLCTAPSTIDPCADSGCGL
HAQCRVEGSRPVCFCPPNYPSGNPRVECALEKPSMRTDCRTEGCGEGASCVADGTLYVCR
CQTGLQGNPDVRCSADRSCSIDNDCPLDKACVNRQCQDPCSLREACGQNALCSVVLHKAR
CSCPQCYIGRPTLKCSPDPRCGTTTQRPVAVITTPRNPVTSSPRPPTSPVVAACSRDNQC
STNHACNTNLGTCQDPCDFKNVACDQGKRCEVRRHRPVCVCKHGFVLNEAGEMACGPNPI
ECRVDDECASNLACVQGRCTNPCAGTRNPCTASNKVCQVLDHRAVCICVEDCTASVSICL
RDRGCPPTMACVNFQCRNPCENSTCPENRPCYVEEHKAVCKFCPPGFVVNPQYGCIQAVG
CRTDSECPAKEGCVNGRCQVVDIPKEPVVGECPPCNANEECDATTLTCFPV
Download sequence
Identical sequences E9HR61
jgi|Dappu1|332869|NCBI_GNO_21000021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]