SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|333758|NCBI_GNO_26200004 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|333758|NCBI_GNO_26200004
Domain Number 1 Region: 264-526
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 5.78e-78
Family alpha-mannosidase 0.0032
Further Details:      
 
Domain Number 2 Region: 631-1047
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.28e-72
Family alpha-mannosidase, C-terminal domain 0.076
Further Details:      
 
Domain Number 3 Region: 527-632
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 2.94e-21
Family alpha-mannosidase, domain 2 0.0066
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|333758|NCBI_GNO_26200004
Domain Number - Region: 8-48
Classification Level Classification E-value
Superfamily KaiA/RbsU domain 0.0392
Family Circadian clock protein KaiA, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|333758|NCBI_GNO_26200004
Sequence length 1047
Sequence
MASLHKNRRTTLERIEKFVSRIYFTDVNLYGRIYPHQENVDIFHWALPQDQHWKSISFDE
IIKQTFLPQKIGDCFGPTWATHYFKIVVKIPESWSGKEIHLRWNSNSEALLFNSLGEPLQ
GFTGSPDHQKREEFIISKSWEKKGPEELVYFIEMACNSMFGAGKGGMIDAPDPDRKYSLE
MANVAVCDTCAYHLLIDLELLFDMAKELTEADGKGDSRGYQALYAGNQIINAIQADDWKN
SFREAQRVSNEFFKYRNGERAHIIDAMGHCHIDTAWLWTYDETIRKCARSWSSVIALMKD
YPEMTFVCSQAQQFSWVKQYYPSLFEEMKHFISLGRFIPVGGTWVEMDGNIPSGESFIRQ
FLYGQRFFLKEFGIRSQEFWLPDTFGYSAQTPQILKHVGISRFLTQKLSWSLVNKFPHHN
FLWEGIDGSTVIVHFPPGDSYEANCKVSEALKTERNLLDKGRVTRSVMLYGFGDGGGGPH
KPMLDRMERLKDVDGVPKFENSTPNKFFENLEAESSQLCRWVGELYLELHNGTYTSQADM
KKYNRSCEYKLRDAELLLAIAFTLERIPLADLVDLRTNVEEGWRLLLVNQFHDVLPGSSI
ELAHTEAKEWFRKSLQLAAEVVDRCISYLQGTSIASYSLLNTLPWSRNALIYENEKPLKA
ISVKPMSWDDDELGDISPVVMEQGGGIHKISNKWFSVEIDSSGRISSMIHHASGNQVVPT
KEFGNQLVLFDDIPLYWDAWDCMDYHIETRNAVNRPSCTEEEVHVELATPLKVTLKWSQP
VGQKSRVHQKIHITAVHSFIEFETRVEWAENRKFLKVEFPVEVHANQASFDTQFGFLNRP
NHKNTSWDSAKFEVCGHKWADLSEPAWGVSVLNDSKYGWSVHGRTITMSLLRSPKAPDAN
CDMHEHFFRYALMPHNGLKSRSEVIRESYNFNCELISTKVSKDTSTSGSWFTVNSSSVIL
ETIKPCEPVLGDDKTPVKRILVRLFESCGDRTHARIETSLPFVNYMECNGLEEPIGPLLP
FVVSTKGQKFFTASFTPFQIKSFLLSF
Download sequence
Identical sequences E9HTR3
jgi|Dappu1|333758|NCBI_GNO_26200004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]